DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG1561

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_996412.1 Gene:CG1561 / 32108 FlyBaseID:FBgn0030317 Length:635 Species:Drosophila melanogaster


Alignment Length:426 Identity:111/426 - (26%)
Similarity:191/426 - (44%) Gaps:38/426 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VTRVLLELYQRHGIPMVSQP------MAGVGENAYGQVLRVSWPTIVDAA-----TVVVKMAPRN 63
            ||:.|.:|..:....:.:.|      .:..|:|..|.|.|      :.||     ::|||:.|:|
  Fly   228 VTQFLRQLVSQLWPELGANPELRLERASAKGDNYLGVVWR------LQAASDSKRSLVVKLPPQN 286

  Fly    64 EARRSHMHVVDYYAREVFMYQKVFPV-------FRALSPDRNTFTVAPALQANDLKAPDEFLIFE 121
            ..||........:.||...|:...|:       ::.:..||  |.............|:|.::.|
  Fly   287 RVRRKQFFARPCFLRETAAYEVFLPLTALIQDKWKIIGDDR--FRQHALCFGTRQDEPNECIVLE 349

  Fly   122 DLSESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEE 186
            |||.:||..::|.:..:.:.|...:...|:|||.|...::..|.:.:||.:.|:   :|....::
  Fly   350 DLSCAGFSLHNRFLDLSVEHVRRVMLTYAKLHAISLAGKRQLPEKMQQLQQLVD---IFEQRRDD 411

  Fly   187 VTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWN 251
            ..:......|:::.:....:..|....|:............|.|..|.|....|.|||||||.||
  Fly   412 HALGVYFENLKESALSALLAPADDAYRVRLEAYFARGSYFELLLPLVSGFNCEPFAVICHGDCWN 476

  Fly   252 NNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQK 316
            |||||:.....:.. :.:|||:|:.|||.||.|:.::||.||.:|.|..|..:.::.||..:..:
  Fly   477 NNILYKSTERGELE-DVRLIDWQLMRYASPVTDLAYFLFTCTSRRFRQRHLENMLEDYYEELGLQ 540

  Fly   317 LKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDE 381
            |......:|.::||..|:.|:......||::....||.......:|.|:..:||.|::.:|:.  
  Fly   541 LIRLGERVEQLFPRPAFDEQVATKAAVGLLLAMMVLPIVTMQGQDVPDLQAISERIEAGATTD-- 603

  Fly   382 PKYKELIEEYEMLNARTLPIFKRRITGIVEDLIKYN 417
                  :.....|.|.....||:||..::.|.:.:|
  Fly   604 ------LHGAGFLGAGNEATFKQRIREVILDCVDFN 633

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 83/298 (28%)
CG1561NP_996412.1 EcKinase 257..546 CDD:281023 83/300 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454063
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 1 1.000 - - FOG0002485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.