DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31975

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:411 Identity:95/411 - (23%)
Similarity:178/411 - (43%) Gaps:62/411 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RVLLELYQRH--GIPMVSQPMAGV---GENAYGQVLRVSWPTIVDA------ATVVVKMAPRNEA 65
            |.|.|:.:.|  |..:::...:.:   |:| ||.||......:..:      ..:|.|:.|.:..
  Fly    10 RALSEVVEPHVSGSRLLNYHTSSLTKPGDN-YGSVLLAIHARLQKSNGESFEEQLVAKVPPIDPK 73

  Fly    66 RRSHMHVVDYYAREVFMYQKVFPVFRALS-----PDRNTFTVAP-------ALQANDLKA-PDEF 117
            .............|..:|:.:.|....|.     ||.:.|...|       :|::|..|. .:..
  Fly    74 YWQFFQPEQTCLTENAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQNAV 138

  Fly   118 LIFEDLSESGFRPNSRCIMPTYDI--VVCSLKALAELHACSFILQQTDPLQFKQLVE-FVEKDNL 179
            |:.|:|..||:....|  :..:|:  .:.:||.:||.||.|..|:...|..|::.|. |.:|.:.
  Fly   139 LVLENLRSSGYVSGQR--LKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQVRPFFKKFDW 201

  Fly   180 ------FTSDIEEVTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQ 238
                  :.|.::..|:|    .:|:|    ..:|...||.::|   |.:...:.||  ....:..
  Fly   202 HAEAPEWKSVMKAETLE----DIRRA----TNNDSRLVARMKE---LSDQFFEFLA--AAPDRPD 253

  Fly   239 APHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFP 303
            .|...|.|.|||.|||::|:.| :..|||.|:||||.::|...|.||:.:|.:..:..:.:..|.
  Fly   254 GPFTSIIHCDFWINNIMFRYGP-TGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFE 317

  Fly   304 DFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTV 368
            ..::|||...::.|:.....|| ::....|..::::.....:....|...|.::::         
  Fly   318 HMLEAYYEAFERCLRRVGAKLE-VHTFKEFRLEVKRVAYIQVPHAIFMTRFILADS--------- 372

  Fly   369 SEAIQSISTSSDEPKYKELIE 389
              |:...|.:.:.||..::::
  Fly   373 --ALIGDSEAEERPKLTDVLK 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 81/314 (26%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 81/315 (26%)
APH <214..329 CDD:279908 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459658
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.