DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31436

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:435 Identity:97/435 - (22%)
Similarity:181/435 - (41%) Gaps:91/435 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSDNELSYAVTRVLLELYQRHGIPMVSQPMAGVGENAYGQVL---RVSWPTIVD--AATVVVKMA 60
            :..|||..|| :|         |.:...|.:..|:: |..::   ||.:.....  ..::::|..
  Fly    30 LEGNELEAAV-KV---------IDLTFSPASAKGDH-YASIMFRARVKYTNRKGEFQKSLIIKTM 83

  Fly    61 PRNEARRSHM-HVVDYYAREVFMYQKVFPVF----RALSPDRNTFT--VAPALQANDLKAPDEFL 118
            |..|..:..| .....:..|:.:|.||.|.|    |.:..|...:.  :..:|:      |.:.|
  Fly    84 PEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLE------PHQVL 142

  Fly   119 IFEDLSESGFRPNSRCIMPTYDIVVCSLK----ALAELHACSFILQQTDPLQFKQLVEFVEKDNL 179
            |||||:|.|:     .::...|..:..::    .||:.||.|..:|...|       ||:|.   
  Fly   143 IFEDLAEMGY-----IVLRDRDATLDEIRRIYFKLAKWHAVSLKVQNEQP-------EFLES--- 192

  Fly   180 FTSDIEEVT-----------IEF-----GK-AQLRKARIILKESDGDQV-AAVQEVLQLCENQLK 226
            :|..:.|:.           :||     || .:|.|.:...:....|.: ..|:|...:.::|.|
  Fly   193 YTHGLFEMPHVLNDPFMRTGMEFFVELLGKEPELNKYKPYFESIKDDFLERLVEEWKDIRKSQKK 257

  Fly   227 SLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFA 291
            .            .:.|:||||....||:::|: ::....:..|:|||:|...|...|:::.::.
  Fly   258 D------------EYWVLCHGDLHLRNIMFKHK-DTVSLEDCMLLDFQISNLFPLTFDLLYSIYM 309

  Fly   292 CTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYP-RSVFNRQLQQYGVYGLIMGAFSLPFF 355
            ..|...|..::.|.::.|.:.:...||  .:..:|:.| :|...::|.|:..|...:.:..||..
  Fly   310 LLEPEHRWNNWDDLINYYISVLQDVLK--KIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLPLM 372

  Fly   356 ISNANEVIDIDTV---SEAIQSISTSSDEPKYKELIEEYEMLNAR 397
            .:..::.:|...:   .|..:..|.|      |..|:|..:|.||
  Fly   373 WALRDKSVDFGDLLQNEEKRRKCSFS------KGYIKEVTILLAR 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 71/320 (22%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 71/324 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459914
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.