DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31380

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733121.1 Gene:CG31380 / 318701 FlyBaseID:FBgn0051380 Length:405 Species:Drosophila melanogaster


Alignment Length:420 Identity:104/420 - (24%)
Similarity:171/420 - (40%) Gaps:80/420 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLELYQRHGI---PMVSQPMAGVGENAYGQVL---RVSWPTIVD----AATVV--------VKMA 60
            |...||.:.:   .||..|..|.||| ||.:|   .:.:.:||:    |.||:        :|.|
  Fly    14 LRRYYQNNELRVESMVINPALGKGEN-YGAILTRIHLVYSSIVEEHLIAKTVLEYEDAETKMKKA 77

  Fly    61 PRNEARRSHMHVVDYYAREVFMYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSE 125
            |           .|.|.||:.:|::|.|..:.|:.::    :.|.:...|.:.  ..||.||||.
  Fly    78 P-----------YDIYNRELEIYEQVLPKLQELAGEQ----LCPKILHIDRQR--GALIMEDLSY 125

  Fly   126 SGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVE----FVEKDNLFTSDIEE 186
            .||....|........|...|:.||::.|.|.:|:       ..|:|    ..|.|..|.:...|
  Fly   126 KGFVMAPRLQRLDEQHVSLVLRKLAKMQAASAVLE-------NNLLENNFSLTEYDKGFFNRYTE 183

  Fly   187 VTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHA-VICHGDFW 250
            ....:....|:.....||...|.:..|  ::|.........|.|.|.  |.:..|. |:.|||.|
  Fly   184 SFSAYFLGCLKSCANYLKTQAGYEHHA--KLLDELAPYYMGLGLRCF--KQEQTHINVLTHGDLW 244

  Fly   251 NNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQ 315
            .||:::::|  :..|.:..|||||.:.:..|.|||.|.|.....:::|.|........|::....
  Fly   245 TNNMMFKYE--AGVPSDVLLIDFQYAFWGSPTLDIHHLLNTSAVEQVRSELQMKMRGVYHDVFVG 307

  Fly   316 KLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSD 380
            :|:......:.:..|..|:.:.:|...|.:..|...||..: |.:|. |.|..       :..||
  Fly   308 ELQRLGFKGQRLPSRKQFHLESEQKRFYAVHCGLLLLPVLL-NTDET-DADFA-------ALLSD 363

  Fly   381 EPK-----------------YKELIEEYEM 393
            :|:                 .|::::.:|:
  Fly   364 QPRGMDMKRRLYLNPGIQDSIKQMVKHFEL 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 81/306 (26%)
CG31380NP_733121.1 EcKinase 36..314 CDD:281023 81/308 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459596
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.