DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG2004

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001259353.1 Gene:CG2004 / 31809 FlyBaseID:FBgn0030060 Length:425 Species:Drosophila melanogaster


Alignment Length:423 Identity:88/423 - (20%)
Similarity:161/423 - (38%) Gaps:86/423 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PMAGVGENAYGQVLRVSWPTIVDA----------ATVVVKMAPRNEARRSHMHVVDYYAREVFMY 83
            |....|:....:|.|::...:.:|          .:|:||..|.|..||.....|.::..|:..|
  Fly    38 PSGKKGDAYLSRVFRITIYGVKEAEEGQDEKQLEISVIVKAMPDNLHRRRLFRSVIFFRNEINFY 102

  Fly    84 QKVFPVFRALSPDR-----NTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVV 143
            .||.|...|....|     ..|...|...|:.....::|:..||:...|:|...|....:.:..:
  Fly   103 TKVLPAIEAFQKSRQPAPKKPFVEYPRCLASLCDGVNDFIALEDVGPRGYRAPVRQDYISLEDAL 167

  Fly   144 CSLKALAELHACSFILQQTDPLQFKQLVEFVEK------------------DNLFTSDIEEVTIE 190
            .:::.|...|..:......|...|::....:|:                  :|:.|..:::    
  Fly   168 LTMRTLGRFHGVALAFNALDSKNFEKAAGSLEETYYGEHTREWYTGFLLLAENVATDAVKQ---- 228

  Fly   191 FGKAQLRKARIILKESDGDQVAA-------VQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGD 248
                       |...|..:.||.       ..:::.|...:.|.              :|..|||
  Fly   229 -----------IYPNSKYETVATNFLQPPLFDDLINLVSTRSKL--------------SVFGHGD 268

  Fly   249 FWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTM 313
            .|..|.|.::.... |..|..:||||::|.:...||:..::::||.:.||::|:.:.:.||..:.
  Fly   269 CWTPNFLTKYNERG-QSEEIIIIDFQLARCSSLALDLSFFIYSCTSQELREQHYDELLRAYLESA 332

  Fly   314 DQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSE-----AIQ 373
            ...::....:.|.|........:|:.:|.:|..||..|||..:...:||.|:|.:.|     .|.
  Fly   333 QDLIQDLGGNAESIISWESLQEELKNFGRFGCGMGIESLPMTMMEDDEVADLDGIKENAILTDIW 397

  Fly   374 SISTSSDEPKYKELIEEYEMLNARTLPIFKRRI 406
            :|:...:..|.:.|.:           |||..|
  Fly   398 NITPFKESAKQQRLAD-----------IFKHAI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 64/326 (20%)
CG2004NP_001259353.1 EcKinase 42..340 CDD:281023 64/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.