DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG32195

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001262006.1 Gene:CG32195 / 317907 FlyBaseID:FBgn0052195 Length:401 Species:Drosophila melanogaster


Alignment Length:439 Identity:86/439 - (19%)
Similarity:166/439 - (37%) Gaps:120/439 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IPMVSQPMAGVGENAYGQVLRVSWPTIVDAATVVVKMAPRNEARRSHMHVVDYYAREVFMYQKVF 87
            |..|||.    |||....:.||:         :|.:.:| :.|..|..:::          :.:.
  Fly    31 IKAVSQK----GENFCSVIYRVA---------LVFRRSP-DGALESGKYIL----------KDLL 71

  Fly    88 PVFRAL-SPDRNTFTV-APALQA--------------------NDLKAPDEFLIFEDLSESGFRP 130
            |...|| :.:::.|.| .||:||                    .::.|..|..|.|||...|:..
  Fly    72 PAAAALGTNEKDMFEVLLPAMQAILEEAPKEIGEHKLSADCLLVEISAGKELYILEDLGALGYES 136

  Fly   131 -NSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKA 194
             :.|..:...:..:| ::.||:.|..|.:|.:..|    :|::.:...: :.:.:.:   .|.:|
  Fly   137 FDRRQGLNLEEAKIC-VRKLAQFHGASKVLYEKKP----ELIQRLSPSH-YANGLND---RFAQA 192

  Fly   195 QLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHA----------------- 242
                  ::|:.::....|..:|:.::.:..           |||.|.|                 
  Fly   193 ------LVLEGAEYAAEAFAEELPEISKKM-----------KAQIPKAYTKRMRDVVDPNKSSLN 240

  Fly   243 VICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMD 307
            .:.|||.|.|||::.....     :|.|:|||...:..|.:|:....:...:..|...:..:.::
  Fly   241 AVIHGDPWLNNIMFDFVNK-----KATLVDFQNCYWGSPAIDLYFLFYTSLKPELLLNNQDELLN 300

  Fly   308 AYYNTMDQKLKSCNL--------SLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVID 364
            .|::.:.:.|:.|..        .|:....|.:|      ||.|.::.   .||...::....:|
  Fly   301 YYFDNLLETLRHCGYKDTLPTFGQLKDEMKRCLF------YGYYTVVC---ELPICCASPEASVD 356

  Fly   365 IDTVSEAIQSISTSSDEPKYKELI--EEYEMLNARTLPIFKRRITGIVE 411
            ....:    .:.|.:...|..:|.  |........||.:|.|.  ||:|
  Fly   357 FGVHT----FVDTDAMLKKRHQLFASERVRQTIKATLLMFDRE--GILE 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 61/326 (19%)
CG32195NP_001262006.1 EcKinase 37..315 CDD:281023 62/332 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459602
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.