DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG33301

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001285793.1 Gene:CG33301 / 2768917 FlyBaseID:FBgn0053301 Length:407 Species:Drosophila melanogaster


Alignment Length:363 Identity:87/363 - (23%)
Similarity:151/363 - (41%) Gaps:62/363 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SQPMAGVGENAYGQVLRVSWPTIVD---------AATVVVKMAPRNEARRSHMHV-VDYYAREVF 81
            ::|..|.|||..|.:.|:    .||         ..|.:||.|...|..::.:.. .:.|.||:.
  Fly    31 AKPATGKGENFVGVMTRI----YVDYQLGDGSVVNKTYIVKQALSAEVPQAEVFFEYELYTREMD 91

  Fly    82 MYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEF--LIFEDLSESGFRPNSRCIMPTYDIVVC 144
            ||:.:.|..:.|..:..   :...|.|:.:....|:  :|.|||:...|....|...........
  Fly    92 MYEFILPKLKELLQEAG---LDQKLTADAITVDREYNTMILEDLAPYKFVNADRVKQLDMAHTEL 153

  Fly   145 SLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKA--RII----- 202
            :|:.||:.||.|.:||:..|    .|:......:.|:.|.:..::.|  |.|.||  |.|     
  Fly   154 TLEMLAKFHAASIVLQERHP----NLLTKCFYTHFFSRDKKAYSVVF--AGLFKAFLRFIDGQPN 212

  Fly   203 LKESDGDQVAAVQ--------EVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHE 259
            |||:.||::..::        ....:.|:.||:|.                |||.|..||:::::
  Fly   213 LKEAYGDKLHKLRTHIMEYGARAYDVGESDLKTLN----------------HGDCWTTNIMFQYD 261

  Fly   260 PNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSL 324
             ::.:|.....||||.|....|.:|: ||.|..:.:....:...:.::.:|..:...|:  ..|.
  Fly   262 -DAGEPRSVVAIDFQFSNCTSPTIDL-HYFFTTSLREEVGDKESELVEHHYKALKANLE--KFSY 322

  Fly   325 EGIYPR-SVFNRQLQQYGVYGLIMGAFSLPFFISNANE 361
            :|..|. ..:..|.::.....|:...|. |..|.|.:|
  Fly   323 KGSLPTLQEYRLQFERRRFMSLLAHMFK-PCMIYNGSE 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 75/313 (24%)
CG33301NP_001285793.1 EcKinase 37..322 CDD:281023 75/317 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459590
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.