DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and nhr-246

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001256661.1 Gene:nhr-246 / 191499 WormBaseID:WBGene00014192 Length:386 Species:Caenorhabditis elegans


Alignment Length:323 Identity:73/323 - (22%)
Similarity:135/323 - (41%) Gaps:53/323 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VVVKMAPRN-------EARRSHMHVVDYYAREVFMYQ---KVFPVFRALSPD----RNTFTVAPA 105
            ||:|: |:|       |.....:..||:...|.||:.   ..:.:|.:||..    ..|:..:.|
 Worm    63 VVLKI-PQNTKGCSVVENAGGGVKNVDHSVVERFMHNTECNYYKLFSSLSEKPLQIPTTYLASKA 126

  Fly   106 LQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTY--DIVVCSLKALAELHACSFILQQTDPLQFK 168
            .:    |||...::.|.|.:.....    ::|.:  |.:...:..|.:||..|...:     ::|
 Worm   127 GE----KAPVPVIVLEMLEDCKLHD----LIPGFNEDQLFKIVDELVKLHIFSLTTE-----KWK 178

  Fly   169 QLVEFVEKDNLFTSD-IEEVTIEFGK--AQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLAL 230
            ::|.  ::..|..|. ::.:..:.|:  ||..:..:||        :.|:..|....|.|:.:..
 Worm   179 EIVP--DESKLAMSGFLQCMVADVGRKLAQNPELGVIL--------SYVENTLDTDPNYLQKMRD 233

  Fly   231 YCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEK 295
            ..::  .:.| :||||||.|...||:..|.|.     |.::|:|.:....|:.|:.|.|..||..
 Worm   234 EYIN--EERP-SVICHGDLWAPQILWDKEDNI-----AGIVDWQATHRGSPMEDLHHILSTCTSV 290

  Fly   296 RLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISN 358
            :.|.......:|.|||.:...||  ....:..:.|...:.:.....:||.....|:..|:.::
 Worm   291 QNRKTFTKPLLDHYYNKLKVGLK--EKGFKTTWTREEIDIEYNYSFIYGASRTIFANGFWANS 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 68/284 (24%)
nhr-246NP_001256661.1 CHK 134..314 CDD:214734 49/208 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.