DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and T16G1.6

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_506234.2 Gene:T16G1.6 / 188554 WormBaseID:WBGene00011800 Length:431 Species:Caenorhabditis elegans


Alignment Length:380 Identity:89/380 - (23%)
Similarity:142/380 - (37%) Gaps:104/380 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NEARRSHMHVVDYYA-------REVFMYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIF 120
            |||:..|...|::|.       .|..:..|:|     .|...::        .|.||.   ||..
 Worm   113 NEAQHLHNREVNFYVLAEKWNKPEELLNAKIF-----FSKKFDS--------ENKLKG---FLGM 161

  Fly   121 EDLSESGFRPNSRCIMPTYDIVVCSLKALAELHACSF-----ILQQTDPLQFKQLVEFVEKDNLF 180
            |.:.:...| :..|.:..|::... |||:|:|.|.|.     .||......|||::     ..:|
 Worm   162 EYVDDVTIR-HLYCNLKPYELHPV-LKAVAQLQAESLHLSDEELQSISGFDFKQMM-----GTMF 219

  Fly   181 TSDIEEVTIEFG-KAQLRKARII----LKESDGDQVAAVQEVL--QLCENQLKSLALYCVDGKAQ 238
            ..|        | |...::.|.|    |||......|...||:  :...|..|.:.::       
 Worm   220 NDD--------GLKGNYKQTRDINPERLKEKTDIVEAFGMEVVNFEFAGNLNKVVGIH------- 269

  Fly   239 APHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRL-RDEHF 302
              ..|:.|||.|..|||:..  |..:...:|:||:|:.....|..|:|. :|.||.... |..|:
 Worm   270 --KDVLVHGDLWAANILWNE--NDGKFSASKVIDYQIIHMGNPAEDLVR-VFLCTLSGADRQAHW 329

  Fly   303 PDFMDAYYN-------------TMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYG-LIMGAFSLP 353
            ...::.:|.             |:||..:|..|                 |.|.| |:|    ||
 Worm   330 EKLLEQFYEYFLEALEDNEIPYTLDQLKESYRL-----------------YFVTGSLVM----LP 373

  Fly   354 FFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYEMLNARTLPIFKRRITG 408
            .:...|...:.....:|.::.......| |.::|:|:.|..:     .:.|.:||
 Worm   374 LYGPIAQTKLSYSKDTEHVEEYREILTE-KAEKLLEDMEHWH-----FYSRNLTG 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 71/290 (24%)
T16G1.6NP_506234.2 DUF1679 8..417 CDD:369592 86/373 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.