DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and T16G1.3

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_506237.2 Gene:T16G1.3 / 188553 WormBaseID:WBGene00011797 Length:389 Species:Caenorhabditis elegans


Alignment Length:272 Identity:65/272 - (23%)
Similarity:111/272 - (40%) Gaps:46/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 LKALAELHACSFILQQTDP-----LQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKE 205
            ||:||...|.|..|.:.:.     ...:::|..:...|...|..|:|. :..|.:|.:|      
 Worm   149 LKSLAVFQAESLKLNKREQESVTGYDLEKIVGKMFSQNGLNSIFEQVR-QINKEELSEA------ 206

  Fly   206 SDGDQVAAVQEV-LQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAK 269
            :|...|..|:.| ..|.:|....|.:         ...|:.|||.|:.||:::.  |.|:....|
 Worm   207 ADKIAVFGVELVNFDLVKNLNNYLGI---------KKNVLVHGDLWSANIMWKE--NKDEFRVDK 260

  Fly   270 LIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNL--SLEGIYPRSV 332
            :||:|......|..|:|....:......|.:::...::.:|....:.|:..|:  :||       
 Worm   261 IIDYQSIHLGNPAEDLVRLFISTLSGSERQKYWEKLLEQFYEYFIEALEDKNVPYTLE------- 318

  Fly   333 FNRQLQQ-YGVYGLIMGAFSLPFFISNAN----EVIDIDTVSEAIQSISTSSDEPKYKELIEEYE 392
               ||:: |.:|.:......||.|...|.    |:.|.|.|.: .:.|.|.    |.|.|:.:.|
 Worm   319 ---QLKESYRLYFVTGSLLMLPMFGPIAEVKLAEMSDPDEVKK-YREILTE----KTKRLLNDME 375

  Fly   393 MLNARTLPIFKR 404
            ..:..|..|.|:
 Worm   376 HRHLYTREIIKK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 41/180 (23%)
T16G1.3NP_506237.2 PKc_like 1..381 CDD:389743 62/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.