DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and C29F7.1

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001379235.1 Gene:C29F7.1 / 183016 WormBaseID:WBGene00007810 Length:394 Species:Caenorhabditis elegans


Alignment Length:271 Identity:55/271 - (20%)
Similarity:102/271 - (37%) Gaps:67/271 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FRPNSRC----IMPTY-------DIVVCSLKA-LAELHACSFILQQTDPLQFKQLVEFVEKDNLF 180
            |..|:.|    :...|       .::.|:.|| .||......:::..:......|::..:||.||
 Worm   102 FMHNTECNYYNVFRKYTDLPMKVPVIYCAAKAGDAEAPVPVIVMEMFEDCTVHDLIDGFDKDQLF 166

  Fly   181 TSDIEEVTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAP----- 240
            ....|.|.:........:.|.:|.:|      |:::.:.|.|..:|::|    :..|::|     
 Worm   167 KIVDEIVNLHIFSLTTEEWRSVLPDS------AMRDTVDLFEAMVKTIA----ENMAKSPGLEII 221

  Fly   241 ---------------------------HAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRY 278
                                       .:|:.|||.|:..||:..:.|.     |.:||:|:...
 Worm   222 SKYIEKTFDKDPSFMTKFSDEYLEGKRKSVLTHGDLWSPQILWDKDDNI-----AGIIDWQVGHQ 281

  Fly   279 APPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGI---YPRSVFNRQLQQY 340
            ..|:.|:...|...|....|::.....:|.|:    :|| |..|..:|:   :.|...:.:....
 Worm   282 GSPMEDLHRILSTGTSVENRNKLTKPLLDHYF----EKL-SAGLEEKGVKMPWTREEVDEEYNHC 341

  Fly   341 GVYGLIMGAFS 351
            ..||..:..||
 Worm   342 FSYGASITIFS 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 48/236 (20%)
C29F7.1NP_001379235.1 CHK 142..322 CDD:214734 40/199 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.