powered by:
Protein Alignment CG13813 and dhs-27
DIOPT Version :9
Sequence 1: | NP_649195.1 |
Gene: | CG13813 / 40218 |
FlyBaseID: | FBgn0036956 |
Length: | 430 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_508591.3 |
Gene: | dhs-27 / 180632 |
WormBaseID: | WBGene00000990 |
Length: | 320 |
Species: | Caenorhabditis elegans |
Alignment Length: | 48 |
Identity: | 14/48 - (29%) |
Similarity: | 19/48 - (39%) |
Gaps: | 14/48 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 147 KALAELHACSFILQQTDPLQFKQLVEFVEKDNL--FTSDIEEVTIEFG 192
|.|.|.|.|..:....| .|||:| ...|:| |::.|
Worm 92 KELVEQHGCEVMCHVHD----------FEKDDLSALPKDLE--TLDVG 127
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.