DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and F59B1.8

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_504022.2 Gene:F59B1.8 / 178784 WormBaseID:WBGene00019100 Length:420 Species:Caenorhabditis elegans


Alignment Length:286 Identity:69/286 - (24%)
Similarity:120/286 - (41%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 TYDIVVCSLKALAELHACSFILQQTDPLQ----FKQ-LVEFVEKDNL-----FTSDIEEVTIEFG 192
            |.|.:...|||||.|.|.|...:....|.    |:: |::.:.:|.|     .:.:|::      
 Worm   176 TVDELQPILKALARLQALSLSTESCRNLDNGEAFEESLMDMLSEDGLKGIFDQSRNIDQ------ 234

  Fly   193 KAQLRKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYR 257
            |...:..||   |.:..::..::.||.|  |::..     :|.|      ||||||.|..|||:.
 Worm   235 KLSEKVERI---EQNHKEILNLETVLNL--NKVVG-----IDQK------VICHGDLWAANILWT 283

  Fly   258 HEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCN- 321
            ......  :..|::|:|.|....|..|:|..|.:......|..|:...::.:|.....::.|.| 
 Worm   284 QTDGGF--IADKVLDYQESHMGNPAEDLVRLLVSTISGADRQSHWEHILEQFYTYFTDEIGSNNA 346

  Fly   322 -LSLEGIYPRSVFNRQLQ-QYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKY 384
             .:||          ||: .:.:| ..:||.:|   ||.....:|:     .:|.:.:...|...
 Worm   347 PYTLE----------QLKTSFKLY-FPVGALTL---ISLFGPAVDM-----KLQGMESGKAENYR 392

  Fly   385 KELIEEYEMLNARTLPI--FKRRITG 408
            :.:||:.:.|....|..  |.::.||
 Worm   393 RIVIEKVDCLLDDVLNFHDFNKKFTG 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 48/192 (25%)
F59B1.8NP_504022.2 DUF1679 8..414 CDD:369592 67/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.