DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and C04F6.7

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001379617.1 Gene:C04F6.7 / 13219936 WormBaseID:WBGene00195081 Length:447 Species:Caenorhabditis elegans


Alignment Length:180 Identity:43/180 - (23%)
Similarity:68/180 - (37%) Gaps:33/180 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 ICHGDFWNNNILYRHEPNSDQPVE---AKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDF 305
            :||||.|..|:::....:..:...   ..:||:|.........|..|.|..|.:..:|.:....|
 Worm   292 LCHGDLWFYNLMWIPRKSGSEVASNHLGSIIDWQNVHTGNICEDFCHMLTFCCDTEIRRQAENTF 356

  Fly   306 MDAYYNTMDQKL----KSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDID 366
            :..|||.:..|.    |..||:|         |:.|:.|. ...|..|..|||.:|....|...|
 Worm   357 LPYYYNQLKAKAVEAGKKLNLTL---------NQFLRAYR-RNFIAHALHLPFIVSIMLCVKPAD 411

  Fly   367 TVSEAIQSISTSSDEPKYKELIEEYEMLNARTLPIFKRRITGIVEDLIKY 416
              .|.:|.|..              :||..:.|..::..|..:.|:..:|
 Worm   412 --DEIVQKIRN--------------QMLIQKVLGAWEDAIQAMHEEYPEY 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 20/83 (24%)
C04F6.7NP_001379617.1 CHK 184..366 CDD:214734 18/73 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D832683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.