DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17147 and Peritrophin-A

DIOPT Version :10

Sequence 1:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:241 Identity:60/241 - (24%)
Similarity:87/241 - (36%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VLLLATVAL--SASVGEYEELCRLFKNGTKV-RKPGTCDQYIQCYDGNGTVLTCPSNQSFNPSKG 74
            ||:||.:|.  :.:||..|  |. .|.|.:. .....|||:..|.:|..|:.||.:...|: .||
  Fly     9 VLILAWIACGHALAVGSPE--CP-EKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFD-GKG 69

  Fly    75 SCVDTLANSNKYCGNR----CEGLDGEWVADPT------------------ECH-KYFYCMNGVP 116
            :.       :.:|...    |:|  .:|  |||                  :|. .|..|.:|.|
  Fly    70 AV-------HNHCNYNWAVDCKG--RQW--DPTPISTPACEYQFGLYAVSKDCSTTYIKCAHGEP 123

  Fly   117 LAGMCPVGQHFDERSQSCLYG------------VDSMC---VDVNNICELVAENTKFRNEKDCAY 166
            ....|..|..:|||...|.:.            |...|   ||.|::........:|....||..
  Fly   124 HEQDCDAGLAYDERIHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHR 188

  Fly   167 YYECDKTGNHASKSC---------TVTSKKREYFDVESGNCVEANK 203
            ...|.: |:....||         |:|.:..||   .||:|....|
  Fly   189 LITCVE-GHPRLISCGEDKVFDEHTLTCEDPEY---ASGSCANYGK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/32 (34%)
ChtBD2 89..136 CDD:214696 17/69 (25%)
CBM_14 278..332 CDD:426342
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:426342 12/54 (22%)
CBM_14 103..147 CDD:426342 11/43 (26%)
ChtBD2 179..218 CDD:214696 9/39 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.