DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17147 and Mur18B

DIOPT Version :10

Sequence 1:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster
Sequence 2:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster


Alignment Length:112 Identity:29/112 - (25%)
Similarity:36/112 - (32%) Gaps:37/112 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GTCDQYIQCY------DGNGTVLTCPSNQSFNPSKGSCVDTLANSNKYCG---------NRCEGL 94
            |.|.:|..|.      ......||||....|:||.|.||..||.    |.         .|..|:
  Fly   291 GDCSRYHNCLLNPVLRQLQDIELTCPELTVFSPSLGRCV
RDLAE----CQVESFPCLSVGRFAGI 351

  Fly    95 DGEWVADPTECHKYFYCMNGVPLAG-------MCPVGQHFDERSQSC 134
            |..:         |:.|:  ..|.|       .|..||.|:.....|
  Fly   352 DETY---------YYSCV--ASLQGGFHKFIVRCSSGQRFEPLIGGC 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 12/37 (32%)
ChtBD2 89..136 CDD:214696 12/53 (23%)
CBM_14 278..332 CDD:426342
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616
ChtBD2 278..329 CDD:214696 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.