DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17145 and LOC4576210

DIOPT Version :10

Sequence 1:NP_649192.2 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster
Sequence 2:XP_001237816.2 Gene:LOC4576210 / 4576210 VectorBaseID:AGAMI1_010698 Length:373 Species:Anopheles gambiae


Alignment Length:54 Identity:16/54 - (29%)
Similarity:22/54 - (40%) Gaps:9/54 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 PKSCYGYYYCADEETALYGTCPQETHFNATTQM--------CSRQHESDCTTST 146
            |.:|..:|.|..::...| .||...|||....:        |..|...|.||:|
Mosquito    48 PTNCSRFYECHMKDAWEY-ECPAGLHFNVAIDVCDFPVNAKCESQSPGDQTTTT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17145NP_649192.2 CBM_14 91..142 CDD:426342 12/48 (25%)
CBM_14 278..327 CDD:426342
LOC4576210XP_001237816.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.