DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17145 and CG4835

DIOPT Version :9

Sequence 1:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:450 Identity:87/450 - (19%)
Similarity:138/450 - (30%) Gaps:168/450 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 NGRNE-DIC---RLFSN--------NTVIRDP-----------ESCSQSITCIDSVSYYSTCTGS 64
            ||..: |.|   :||:|        ::|..||           :..:.|:|...|:    |.|.|
  Fly   295 NGCTDLDYCQPDKLFNNWLHICDTPDSVRCDPLPFPTTPGTTNKPTTPSVTTTPSI----TTTPS 355

  Fly    65 TPFFDKDTGKCVKSLSTSTSSCSISCADRAKQFVADPK---------------SCYGYYYCADEE 114
            ||......|...: :.:||:...::..|.....| ||.               :|..|..|.|.:
  Fly   356 TPTTLPSDGSTTE-IHSSTTEEIVTTTDGLPSDV-DPNDCKDEKDGTIFAYIGNCSEYLICKDNQ 418

  Fly   115 TALYGTCPQETHFNATTQMCSRQHESDC-------------------------TTSTF------- 147
            ..: |.||..|.||....:|....:..|                         ||:|.       
  Fly   419 VQM-GHCPPNTLFNPDLLVCDEPDDVVCLGDRTTTPIPTTIPTTTTEKTTPTTTTTTVATTLGPD 482

  Fly   148 EYCSIVKNGVNFDNLQGCNMYHVCEKGVLKDKTCSK----TYYQASTGECVSKALVDC------- 201
            :.|...:.|.:|.....|:.|::|..|  ...|.:.    :|:..|||:|......|.       
  Fly   483 QLCDGQELGASFSYPDDCSKYYLCLGG--GQWTLAPCIYGSYFDPSTGQCGPDVAPDACKPSQVT 545

  Fly   202 -------------DAHPLP-----------------TDVCGKASKPYENKFVADEATCRGYFYCA 236
                         :.:..|                 |.:||..:   ||:.:|....|..|..|.
  Fly   546 TTTTTTTTETTTTERNTTPKSTATTTERTTTTVAPKTGICGGRN---ENENIAYPNNCTKYIVCV 607

  Fly   237 KQKDGTPDPNPVWNQCPQDRFFDASSQMCI------------------------TPSSVYCSHDR 277
                   .|.|:...||...||.:..:.||                        .|....|::..
  Fly   608 -------SPIPIAFFCPDGTFFSSKLEKCIDDWDESDCEGDQSTTTLEPGYTRPPPEPTMCTNSS 665

  Fly   278 CDGRTASFVVSATKGCRNYLSCSDG--VTVSERSCGNYF--FDDQQGACTPSVQTYTACK 333
            .|      .......|:.::.|.|.  ..:...:||.|:  ..::.||..||    .||:
  Fly   666 RD------TFPYPDNCQWFIRCVDDYIYMMDVCNCGEYYDPITEKCGADVPS----DACR 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 15/65 (23%)
CBM_14 278..327 CDD:279884 11/52 (21%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884 7/26 (27%)
CBM_14 393..444 CDD:279884 11/51 (22%)
CBM_14 485..539 CDD:279884 14/55 (25%)
CBM_14 585..638 CDD:279884 16/62 (26%)
CBM_14 661..714 CDD:279884 12/62 (19%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444062
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.