DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17145 and obst-B

DIOPT Version :9

Sequence 1:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:189 Identity:41/189 - (21%)
Similarity:66/189 - (34%) Gaps:29/189 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DPESCSQSITCIDSVSYYSTCTGSTPFFDKDTGK----------CVKSLSTSTSSCSISCADRAK 95
            |.:.|.:...|:|.|.....|.....|.|....:          |:|.....|...|:.|..:..
  Fly    95 DSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRSKLQTPQPSLHCPRKNG 159

  Fly    96 QFVAD-PKSCYGYYYCADEETALYGTCPQETHFNATTQMCSRQHESDCT----TSTFEY-CSIVK 154
            .|..: |..|..:|:|.|.:..:. |||....||..|.:|....:...|    ...|:: |..|.
  Fly   160 YFGHEKPGICDKFYFCVDGQFNMI-TCPAGLVFNPKTGICGWPDQVGVTGCKSEDVFDFECPKVN 223

  Fly   155 NGV-----NFDNLQGCNMYHVCEKGVLKDKTCSKTYYQASTGECVSKALVDCD-AHPLP 207
            ..:     .:.:...|..::||..|.|..:...|      .|:...:....|| |..:|
  Fly   224 ESIAVTHPRYADPNDCQFFYVCVNGDLPRRNGCK------LGQVFDEEKETCDWARKVP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 13/51 (25%)
CBM_14 278..327 CDD:279884
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 8/43 (19%)
CBM_14 156..204 CDD:279884 13/48 (27%)
CBM_14 233..278 CDD:279884 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.