Sequence 1: | NP_001262098.1 | Gene: | CG17145 / 40215 | FlyBaseID: | FBgn0036953 | Length: | 334 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723116.1 | Gene: | obst-E / 33806 | FlyBaseID: | FBgn0031737 | Length: | 249 | Species: | Drosophila melanogaster |
Alignment Length: | 202 | Identity: | 49/202 - (24%) |
---|---|---|---|
Similarity: | 70/202 - (34%) | Gaps: | 48/202 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 155 NGVNFDNLQGCNMYHVCEKGVLKDKTC--SKTYYQ--ASTGECVSKALVDCD--AHPLP---TDV 210
Fly 211 CGKASKPYENKFVADEATCRGYFYCAKQKDGTPDPNPVWNQCPQDRFFDASSQMCITPSSVYCSH 275
Fly 276 ------------DRCDGRTASFVVSATKG----------CRNYLSCSDGVTVSER--SCGNYF-F 315
Fly 316 DDQQGAC 322 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17145 | NP_001262098.1 | CBM_14 | 91..142 | CDD:279884 | |
CBM_14 | 278..327 | CDD:279884 | 15/58 (26%) | ||
obst-E | NP_723116.1 | ChtBD2 | 23..65 | CDD:214696 | 10/36 (28%) |
CBM_14 | 95..146 | CDD:307643 | 14/60 (23%) | ||
CBM_14 | 180..225 | CDD:307643 | 11/40 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |