DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6933 and obst-F

DIOPT Version :9

Sequence 1:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:333 Identity:70/333 - (21%)
Similarity:107/333 - (32%) Gaps:105/333 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 IGNPSNCHAWGYCKNQEVVAWGTCPNGLVFNAQAGSCDYANTTVC---STSAVETCSNV------ 106
            :.:|.:|:.:..|.....:.:  |..||.|:.....||....|.|   :|..||:.:.:      
  Fly    52 VPHPLDCNGYFSCSRVPTLLY--CDQGLQFDENRAICDLPENTNCRPVATGTVESANGLADNSEL 114

  Fly   107 ------KSPMYVA------NPLNCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIWGPACPQDTI 159
                  ..|::||      .|:|..|          .|.                     |:...
  Fly   115 NWWPHKPKPVFVAVDVTSGQPVNPME----------KYD---------------------PEHIE 148

  Fly   160 CRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCS-STANPYYNKATGNCQSTNP--CTGEDSNSGN 221
            ||. ....|:..|..||.|..|..|:....:|. .||   :|.....||.::.  |.||      
  Fly   149 CRH-YGAYFLPHPRNCGLYFICAYGHLHRHQCGRGTA---WNFEKSECQLSDQAICYGE------ 203

  Fly   222 SDQFTVGQTNATACDEEAFKAADPLTVNGESVDYRYVSDGVTCYGYYYCAAVNATGY--WNQCPT 284
             .|.:...|:.    |...|..   |.|.|.        .||     .|..|.::.|  ..|..|
  Fly   204 -SQISEPHTDV----ETTMKVP---TANSEG--------AVT-----VCYIVGSSEYTTLQQFLT 247

  Fly   285 GTQFNAGKCVSPAS--------FVCTHNRCGNVNNPFMADEGCKNYTICSSG--ITGSCPTNAPY 339
            ..:......|:|.|        ..|...:...:::|    |.|..|.||..|  :..|||... :
  Fly   248 SPEITELPPVTPPSPPRAEANALTCPSTKQSYMSHP----EDCSKYYICIGGMPVLTSCPKGL-F 307

  Fly   340 YDEVNNIC 347
            :|:.:..|
  Fly   308 WDQKSGFC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 9/38 (24%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 10/43 (23%)
CBM_14 156..198 CDD:279884 13/44 (30%)
CBM_14 272..321 CDD:279884 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444088
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.