DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6933 and CG7248

DIOPT Version :9

Sequence 1:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_648530.1 Gene:CG7248 / 39356 FlyBaseID:FBgn0036229 Length:796 Species:Drosophila melanogaster


Alignment Length:473 Identity:96/473 - (20%)
Similarity:147/473 - (31%) Gaps:205/473 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 PS--NCHAWGYCKNQEVVAWGTCPNGLVFNAQAGSCDYANTTVC------------STSAVET-- 102
            ||  ||:.:..|.|.:...: .||..::||.....||..:...|            :|.|.|:  
  Fly   142 PSAENCNEFYLCVNDQSKVY-RCPGEMLFNPDLNICDDKDNVWCYGDRTTPDPLDTTTPAEESFT 205

  Fly   103 -CSNVKSPMYVANPLNCTEYAYCDGTGQISY---------------GDCG--------------- 136
             |.:.:...:..:|.||.:|.||  .|..||               |:||               
  Fly   206 KCEDQEKGTFFPDPENCQQYYYC--WGNKSYTILPCPVDNWFNPISGNCGPDIAPDACRETTPTS 268

  Fly   137 TGGVYSASSTKCIWGPACPQDTICRFMLSNIFVGDP-------------NQCGNYINCV-NGYGT 187
            |..:.::|||..  .|...:|:          ||:|             :.|.:|:.|: ||..|
  Fly   269 TPTIDTSSSTTV--APTSTEDS----------VGNPCADQELGASFPIKSDCQSYLLCLNNGEST 321

  Fly   188 SEKCSSTANPYYNKATGNC-------------QST----------NPCTGEDSNSG-----NSDQ 224
            :.||.|  |.:::..||:|             ::|          :||..::..:.     |..|
  Fly   322 TAKCPS--NAWFDPKTGDCGPNVSPTACLESFETTTTAVTTQAPKDPCADQELGTSYPLVTNCQQ 384

  Fly   225 FTVGQTNA--------------------------TACDEEAFKAADPLTV--------------- 248
            :.:...|.                          |||.|.....|.|.|.               
  Fly   385 YILCMGNGESTVANCIYNSWFDPQTGNCGPDVSPTACKESGVTTASPTTTSQATSPLTTPSPTWS 449

  Fly   249 ---------------------NGESVDYRYVSDGVTCYGYYYCAAVNATGYWNQCPTGTQFNAG- 291
                                 :|||..| |.:....|..|..||:.....::  ||....||.. 
  Fly   450 TLPTANTEETTTNPPDIVGICSGESDGY-YATYPEVCNKYILCASPVPIAFY--CPESLFFNEAL 511

  Fly   292 -KCVSPASFVCTHNR-----------------CGN---VNNPFMADEGCKNYTICSS------GI 329
             :||...|..|::..                 |.|   :|.|:  .|.|:.|..|:.      ||
  Fly   512 QRCVEWESSDCSNGETTTSSPGFTTPSPDTQICSNSTGLNLPY--QENCQWYIYCTDENSYMMGI 574

  Fly   330 TGSCPTNAPYYDEVNNIC 347
            .||    ..|:|.....|
  Fly   575 CGS----EEYFDPWTGKC 588

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 12/37 (32%)
CG7248NP_648530.1 CBM_14 62..113 CDD:279884
CBM_14 136..182 CDD:279884 12/40 (30%)
CBM_14 207..261 CDD:279884 13/55 (24%)
CBM_14 293..347 CDD:279884 13/55 (24%)
CBM_14 367..421 CDD:279884 5/53 (9%)
CBM_14 470..522 CDD:279884 16/54 (30%)
CBM_14 544..597 CDD:279884 15/51 (29%)
CBM_14 630..678 CDD:279884
CBM_14 710..758 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.