DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6933 and obst-B

DIOPT Version :9

Sequence 1:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:122 Identity:34/122 - (27%)
Similarity:47/122 - (38%) Gaps:19/122 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GYIGN--PSNCHAWGYCKNQE--VVAWGTCPNGLVFNAQAGSC---DYANTTVCSTSAV--ETCS 104
            ||.|:  |..|..:.:|.:.:  ::   |||.|||||.:.|.|   |....|.|.:..|  ..|.
  Fly   159 GYFGHEKPGICDKFYFCVDGQFNMI---TCPAGLVFNPKTGICGWPDQVGVTGCKSEDVFDFECP 220

  Fly   105 NVKS------PMYVANPLNCTEYAYCDGTGQISYGDCGTGGVYSASSTKCIWGPACP 155
            .|..      |.| |:|.:|..:..|..........|..|.|:......|.|....|
  Fly   221 KVNESIAVTHPRY-ADPNDCQFFYVCVNGDLPRRNGCKLGQVFDEEKETCDWARKVP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 17/47 (36%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884
CBM_14 156..204 CDD:279884 17/47 (36%)
CBM_14 233..278 CDD:279884 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.