DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG42397

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:165 Identity:41/165 - (24%)
Similarity:69/165 - (41%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 YSVLEQGGCAAGLNYNKELGRCILASSSAAVCPYADSIADKATN-----LCANETEGAFIVDPSS 117
            :::|..|..::|.:.|.:|    ....|..|   .|:.....|.     |||:  |..|:..|  
  Fly    13 FALLVSGSTSSGEDTNIKL----TTDESTTV---EDTTEVLVTTLPPPVLCAD--EDLFLPAP-- 66

  Fly   118 SDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPA---CRS-LPNNTRL 178
             |||.|..|...:.|...||:.|.:......|.::.|: |...:.:.|:|:   |.| ||....:
  Fly    67 -DCREYYQCLYGEGILKICPDGLYWDRELNVCAWDSQH-CADDKNETTTPSTLNCASGLPFLPYI 129

  Fly   179 ADPVHCDQYYECVSEVLHSRACPVASAYDANLGYC 213
            .|   |.::.:||..:....:||....::..|..|
  Fly   130 PD---CTKFIQCVYNIGFKLSCPSGLYWNQPLQSC 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 15/51 (29%)
ChtBD2 246..290 CDD:214696
CBM_14 303..348 CDD:279884
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 13/48 (27%)
ChtBD2 125..163 CDD:214696 8/40 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.