DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG17147

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:372 Identity:99/372 - (26%)
Similarity:158/372 - (42%) Gaps:55/372 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRASGVL---SLLFVASALGGVIEDFEYLSVAEMCDLLPQETSFLRPNTCDNWVRC-ASNYSVL 61
            :|...|||   .||....||...:.::|     |:|.|....|...:|.|||.:::| ..|.:||
  Fly     2 LNLKLGVLLGCVLLLATVALSASVGEYE-----ELCRLFKNGTKVRKPGTCDQYIQCYDGNGTVL 61

  Fly    62 EQGGCAAGLNYNKELGRCILASSSAAVCPYADSIADKATNLCANETE---GAFIVDPSSSDCRGY 123
            .   |.:..::|...|.|:            |::|: :...|.|..|   |.::.||  ::|..|
  Fly    62 T---CPSNQSFNPSKGSCV------------DTLAN-SNKYCGNRCEGLDGEWVADP--TECHKY 108

  Fly   124 ILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTRLADPVHCDQYY 188
            ..|.:...:...||....|...|:||:|.....|     ...:..|..:..||:..:...|..||
  Fly   109 FYCMNGVPLAGMCPVGQHFDERSQSCLYGVDSMC-----VDVNNICELVAENTKFRNEKDCAYYY 168

  Fly   189 ECVSEVLH-SRACPVASA----YDANLGYCVDVAEVSCYESAALPEPENTFCLDSATGSARVGYF 248
            ||.....| |::|.|.|.    :|...|.||:..:|.|    .....||.     .|.|..:.:.
  Fly   169 ECDKTGNHASKSCTVTSKKREYFDVESGNCVEANKVEC----TAHSKENV-----CTSSTTMTFK 224

  Fly   249 ADDESCSHYYICGS--PVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVRCQLDRCVGTNITYV 311
            :|..:|..|::|.:  |||   |.:|....||.|.:||.::..|.:...|.|..:||.|.....|
  Fly   225 SDQATCRGYFVCKALYPVA---DLDPLWTQCPEGYFFDEDRQLCANPTTVVCTHNRCDGRGTMLV 286

  Fly   312 -NVAGDCQSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQTNYHNIAC 357
             :.:.:|.:|.||.....|:...|...::|||..:.|:....::..|
  Fly   287 TSSSNNCHNYIRCVDNKEVTEETCHWDHFFDETVEACSSKIIYDKCC 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 16/54 (30%)
ChtBD2 246..290 CDD:214696 14/45 (31%)
CBM_14 303..348 CDD:279884 12/45 (27%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 11/35 (31%)
ChtBD2 89..136 CDD:214696 14/48 (29%)
CBM_14 278..332 CDD:279884 13/53 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444150
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0005299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.