DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG7298

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:359 Identity:93/359 - (25%)
Similarity:141/359 - (39%) Gaps:59/359 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LFVASALGGVIEDFEYLSVAEMCDLLPQETSFLRPNTCDNWVRCASNYSVLEQGGCAAGLNYNKE 75
            |....|||..|.:..| :|..:|..:...|......:|..:..|.|...|  |..|.:|.:|:.:
  Fly    13 LMGGQALGDAILEGNY-NVTAVCTAVKVGTQLGSIESCQTYYVCQSTGPV--QSSCQSGYSYDYK 74

  Fly    76 LGRCILASSSAAVCPYADSIADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQI-KANCPNE 139
            ...|.  .||...|.:.      ..|.||.: ...::  |:::.|.|:..|...|.. ..|||..
  Fly    75 RSSCY--PSSEVDCYWG------VENPCAGK-NNTWV--PNTAVCGGWFYCLEGKSAGSGNCPVN 128

  Fly   140 LIFHPVSRSCVYEKQYRCPISQ-TKKT--SPACRSLPNNTRLADPVHCDQYYECVSE----VLHS 197
            ..|...:.:|||.   .|..:| |.:|  ...|..:|......|...|..::.|.|.    ||.|
  Fly   129 QKFDTTTLACVYG---TCSNTQGTNETVLESLCDVVPPGQYFGDTESCSTWHYCESTSTGLVLQS 190

  Fly   198 RACPV--ASAYDANLGYCVDVAEVSCYESAALPE-----PENTFCLDSATGSARVGYFADDESCS 255
            ..|..  .:||:.....|.       ||||::..     |.:...:..:|..|:   .||.:.|.
  Fly   191 GKCSANNQTAYNVLANQCT-------YESASVCSRVTNIPLSDAAVSCSTNGAK---SADPKVCG 245

  Fly   256 HYYICGSPVAGKHDTEPKHLS--CPLGQYFDFEKLSCRDRLNVRCQL---DRCVGTNITYVNV-- 313
            .||:|         |..|:::  ||.|.|:|.....|..| .|...:   :||.....|:||.  
  Fly   246 TYYVC---------TNGKNVATYCPTGDYYDDSLGYCVSR-QVATPVAGCNRCQYATSTFVNAVD 300

  Fly   314 AGDCQSYGRCSGGVTVSLGQCPTGYYFDERNQGC 347
            :.:|.:|..|:.....:|..||...:|||..|||
  Fly   301 SNNCSTYYYCNSQGEATLNTCPADTFFDESRQGC 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 14/52 (27%)
ChtBD2 246..290 CDD:214696 13/45 (29%)
CBM_14 303..348 CDD:279884 16/47 (34%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 13/43 (30%)
ChtBD2 286..334 CDD:214696 15/47 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0005299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.