DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and obst-F

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:385 Identity:80/385 - (20%)
Similarity:133/385 - (34%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLLFVASALGGVIEDFEYLSV-------AEMC------DLLPQETSFLRPNTCDNWVRCASNYS 59
            ||:.|...|...|.:.:|...|       :.:|      ||:|      .|..|:.:..|:...:
  Fly    11 LSICFQLGAGHAVDQSWELPKVRHTVGHLSHICLGRQEGDLVP------HPLDCNGYFSCSRVPT 69

  Fly    60 VLEQGGCAAGLNYNKELGRCILASSSAAVC-PYADSIADKATNLCAN--------ETEGAFI-VD 114
            :|.   |..||.:::....|.|..::.  | |.|....:.|..|..|        :.:..|: ||
  Fly    70 LLY---CDQGLQFDENRAICDLPENTN--CRPVATGTVESANGLADNSELNWWPHKPKPVFVAVD 129

  Fly   115 PSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSP---ACRS----- 171
            .:|..                                      |::..:|..|   .||.     
  Fly   130 VTSGQ--------------------------------------PVNPMEKYDPEHIECRHYGAYF 156

  Fly   172 LPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAALPEP----EN 232
            ||:      |.:|..|:.|....||...|...:|::.....|....:..||..:.:.||    |.
  Fly   157 LPH------PRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGESQISEPHTDVET 215

  Fly   233 TFCLDSATGSARVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVR 297
            |..:.:|.....|      ..|   ||.||   .::.|..:.|:.|  :..:...::........
  Fly   216 TMKVPTANSEGAV------TVC---YIVGS---SEYTTLQQFLTSP--EITELPPVTPPSPPRAE 266

  Fly   298 CQLDRCVGTNITYVNVAGDCQSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQTNYHNIAC 357
            .....|..|..:|::...||..|..|.||:.| |..||.|.::|:::..|....  |:.|
  Fly   267 ANALTCPSTKQSYMSHPEDCSKYYICIGGMPV-LTSCPKGLFWDQKSGFCEMEK--NVKC 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 5/60 (8%)
ChtBD2 246..290 CDD:214696 8/43 (19%)
CBM_14 303..348 CDD:279884 15/44 (34%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 13/61 (21%)
CBM_14 156..198 CDD:279884 11/47 (23%)
CBM_14 272..321 CDD:279884 16/51 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.