DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG10140

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:314 Identity:66/314 - (21%)
Similarity:107/314 - (34%) Gaps:77/314 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SVLEQGGCAAGLNYNKELGRCILASSSAAVCPYADSIADKATNLCANETEGAFIVDPSSSDCRGY 123
            |.||.....:||.|....|.                     .::|.|..:..|:  |...||..|
  Fly    32 STLETDSTTSGLEYGLITGN---------------------LSICGNVADNVFL--PFVGDCNRY 73

  Fly   124 ILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTRLADPVHCDQYY 188
            .||:|.:.|:..|.....|:..::|||:.....|        .|.|.:. |.:..:....|.:|.
  Fly    74 YLCRSGQAIELQCEWPYEFNANTQSCVHPGDADC--------LPTCEAF-NFSTFSYQRTCTRYV 129

  Fly   189 ECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAALPEPENTFCLDSA----TGSARVGYFA 249
            .|.......|.|.....|::....|              ..|:|..|::|.    :.:..:.|..
  Fly   130 LCYYGKPVLRQCQDGLQYNSATDRC--------------DFPQNVDCVESECSIYSNAYHLRYVP 180

  Fly   250 DDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVRCQL---DRCVG--TNIT 309
            ...||..|:|||:.:       |:..:|..|.:|..:...|.......||:   :|.|.  :.::
  Fly   181 SKVSCQKYFICGNGI-------PREQTCTAGLHFSTKCDCCDIPSKSDCQIPAVERKVQQLSRLS 238

  Fly   310 YVNVAGDC--------------QSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQ 349
            .|...|.|              .:|..|..|..:.| .|..|.::|...|.|.:
  Fly   239 PVTTVGICPPSGVHFYVHESRRDAYYYCVDGHGLVL-DCSAGLWYDPTVQECRE 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 16/51 (31%)
ChtBD2 246..290 CDD:214696 11/43 (26%)
CBM_14 303..348 CDD:279884 12/60 (20%)
CG10140NP_648648.2 CBM_14 63..106 CDD:279884 14/44 (32%)
CBM_14 111..161 CDD:279884 11/64 (17%)
CBM_14 178..222 CDD:279884 12/50 (24%)
CBM_14 246..295 CDD:279884 10/47 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444156
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.