DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG10725

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:321 Identity:72/321 - (22%)
Similarity:105/321 - (32%) Gaps:110/321 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNRASGVLSLLFVASALGGVIEDF---EYLSVAEMC------DLLPQE----------------- 39
            :|..|.|::.|||.. :|...:.|   ..::|...|      |...||                 
  Fly    24 VNVCSNVVNNLFVPQ-VGNCSKYFLCMNEIAVPRECPTDYYFDARDQECVPLMEVECIGSCKNRG 87

  Fly    40 -TSFLRPNTCDNWVRCASNYSVLEQGGCAAGLNYNKELGRCILASSSAAVCPYADSIADKATNLC 103
             :||....||..:|.|.....|:.|  |:.||.||....||....       |.|.:    .|||
  Fly    88 LSSFCYDRTCTKYVLCFDGTPVIRQ--CSDGLQYNALTDRCDYPQ-------YVDCV----DNLC 139

  Fly   104 A-NETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPI-SQTKKTS 166
            : |......:..||.:.|..|.:|........||.:.|.::|.::||.:..:..|.: |..:...
  Fly   140 SRNNNPDDIVFIPSKARCDKYYICMDGLPQVQNCTSGLQYNPSTQSCDFPSKVNCTVESLQRNIL 204

  Fly   167 PACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAALPEPE 231
            |..|:.|   ||||       .||.||..|                                   
  Fly   205 PFARAPP---RLAD-------IECPSEGAH----------------------------------- 224

  Fly   232 NTFCLDSATGSARVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRD 292
                           :.|..:....||.|   :.|:..|    |.|..|..||.::..||:
  Fly   225 ---------------FIAHQKRQDAYYYC---LNGRGVT----LDCTPGLVFDAKREECRE 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 13/52 (25%)
ChtBD2 246..290 CDD:214696 11/43 (26%)
CBM_14 303..348 CDD:279884
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 9/38 (24%)
CBM_14 83..134 CDD:279884 16/59 (27%)
CBM_14 150..192 CDD:279884 11/41 (27%)
ChtBD2 216..264 CDD:214696 18/105 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.