DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG11570

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:275 Identity:49/275 - (17%)
Similarity:82/275 - (29%) Gaps:105/275 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTRLA 179
            |..:||..|.:|:..:..:..||..|.:..::..|.|::...|                 ||.:.
  Fly    51 PYPNDCSKYYVCQKGRAYEQQCPLNLFWSQMTYRCDYKEYSNC-----------------NTYIP 98

  Fly   180 DPVH------------CDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAALPE--- 229
            .|.|            |.::||  :.:|.   |      :.||.:.      |.|:...:|:   
  Fly    99 SPNHDVEVIFSAYPGDCRRFYE--TRILR---C------EQNLQWS------SVYQRCVVPQYGD 146

  Fly   230 ---------------PENTFCLDSATGSARVGYFADDESCSHYYICGSPVAGKHDTEP-----KH 274
                           |..|:.......:..:.|..            .|.||   |.|     :.
  Fly   147 CQNSPVTVPPVVPFTPLPTYPPVPTVPATVIPYDP------------MPTAG---TPPPITPMES 196

  Fly   275 LSCPLGQYFDFEKLSCRDRLNVRCQLDRCVGTNITYVNVAGDCQSYGRCSGGVTVSLGQCPTGYY 339
            |..|:    |.:.|......|             .|:...|.|:.:..|  |.|.::..|.....
  Fly   197 LPLPI----DVQSLCNNSPPN-------------AYIPYPGSCKKFIHC--GPTATILSCAGSSN 242

  Fly   340 FDERNQGCTQTNYHN 354
            ::.....|  |.|.|
  Fly   243 WNPAQHAC--TTYSN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 10/39 (26%)
ChtBD2 246..290 CDD:214696 10/48 (21%)
CBM_14 303..348 CDD:279884 7/44 (16%)
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 10/41 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.