DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and obst-G

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_648529.1 Gene:obst-G / 39355 FlyBaseID:FBgn0036228 Length:279 Species:Drosophila melanogaster


Alignment Length:271 Identity:56/271 - (20%)
Similarity:88/271 - (32%) Gaps:76/271 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ILASSSAAVCPYADSIADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHP 144
            :|..|:.||  ..:..|.| |:||..:..|..   |....|:||.:|.....:...|....:|:|
  Fly    12 VLQESTLAV--VQNGFAFK-TSLCEGKNGGLL---PMFGSCKGYYVCADGNAVTGTCEKNTLFNP 70

  Fly   145 VSRSCVYEKQYRC--------------------------------PISQTKKTSPA-----CRSL 172
            ::..|.......|                                .:..|||..|.     |...
  Fly    71 LTLHCDDPDNVDCIFDGKDNIVDDTSSSESDEDDDEEMAKTDPPVTVKATKKPRPTTLDKMCAGK 135

  Fly   173 PNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAALPEPENTFCLD 237
            .:...|.....|.:||.|.::..|.|:||....:......|:..:|..|.....    ||    .
  Fly   136 KDGVMLTKNGSCQEYYVCKAKKPHLRSCPDKQHFSPTRRICMKASEAKCSGGTR----EN----K 192

  Fly   238 SATGSARVGYFADDE----------SCSHYYICGSPVAGKHDTEPKHLSCPLGQYF-------DF 285
            .:.|.|..|....||          .|..:.:|.:.:....|       ||.|.:|       |:
  Fly   193 ESDGPATTGGVCSDEKENSLVAHRSDCGKFMLCSNMMFLVMD-------CPTGLHFNIATSRCDY 250

  Fly   286 EKLS-CRDRLN 295
            .|:: |:.:||
  Fly   251 PKIAKCQTKLN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 11/51 (22%)
ChtBD2 246..290 CDD:214696 12/61 (20%)
CBM_14 303..348 CDD:279884
obst-GNP_648529.1 CBM_14 32..83 CDD:279884 11/53 (21%)
CBM_14 132..184 CDD:279884 12/51 (24%)
CBM_14 204..256 CDD:279884 11/58 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444158
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.