DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG13312

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_648260.1 Gene:CG13312 / 39010 FlyBaseID:FBgn0035931 Length:342 Species:Drosophila melanogaster


Alignment Length:311 Identity:66/311 - (21%)
Similarity:102/311 - (32%) Gaps:72/311 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 NTCDNWVRCASNYSVLEQGGC-----AAGLNYNKELGRCILASSSAAVCPYADSIAD-----KAT 100
            |.| |.|...:.||..:...|     :.....:...|...::.||..:|...||.:|     :..
  Fly    31 NVC-NTVNNLTCYSSTQMQSCQVDVLSTATPTDCPSGYVCVSGSSGVLCQPEDSASDSQADCQEC 94

  Fly   101 NLCANETE--------------GAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVY 151
            |.| :||:              |...|..|...|....:|..:.......|.:    .|..:|.|
  Fly    95 NKC-DETQTFACTGTQSFALCLGTDTVQDSVGTCASGYVCNINDTQICGLPAD----GVMPTCSY 154

  Fly   152 -EKQYRCPISQTKKTSPA-----------CRSLPNNTRLADPVH----CDQYYECV----SEVLH 196
             :......:|.|..::.|           |.::.:..:.|...:    |.||..|.    |.:..
  Fly   155 SDDSTTTTVSSTTSSTTAAPPSTSSASTYCAAVQSQGKYAVGYNAYTTCRQYIYCTLVDGSWIGQ 219

  Fly   197 SRACPVASAYDANLGYCVDVAEVSCYESA-------ALPEPENTFCLDSATGSARVGYF---ADD 251
            :..||.:..:|:....||.....:|..:|       |.|...|......|..||  ||:   .|.
  Fly   220 TYTCPGSMYFDSASEMCVSTMPSTCSTTATTSSTTTAAPTTSNPEAYCQAMQSA--GYYPVGTDA 282

  Fly   252 ESCSHYYI-C---GSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVRC 298
            .:..|.|| |   |....|...|      ||...|::....:|...|...|
  Fly   283 STTCHQYIDCFLNGGTWGGNMYT------CPGSLYYNSASRTCVSTLPSTC 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 12/66 (18%)
ChtBD2 246..290 CDD:214696 13/50 (26%)
CBM_14 303..348 CDD:279884
CG13312NP_648260.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.