DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG33985

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:280 Identity:51/280 - (18%)
Similarity:102/280 - (36%) Gaps:87/280 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 VLSLLFVASALGGVIEDFEYLSVAEMCDLLPQETSFLRPNTCDNWVRCASNYSVLEQGGCAAGLN 71
            ::||||:|::...|.::         |:.....:....|.:|.:::.|..:.|.  .|.|..|..
  Fly    11 LVSLLFLATSHADVFDE---------CNDGNNLSFVTSPKSCAHYIFCNGDESY--DGECEDGEY 64

  Fly    72 YNKELGRC-------------------------------------IL------------------ 81
            :::::..|                                     ::                  
  Fly    65 FSQDMEMCEPMGDIDCRTGSEVQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQS 129

  Fly    82 -ASSSAAVCPYADSIADKATNLCA---NETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIF 142
             |||:.:|.|..:.|   .||:|.   |::..|.:  |:.:.|..|.:|.....:..:|...|.|
  Fly   130 GASSTTSVSPAIEII---VTNVCPQLDNQSRIALL--PNQNSCSDYYICYRGVALPMSCATSLHF 189

  Fly   143 HPVSRSCVYEKQYRCPISQTKKTSPACRS-----LPNNTRLADPVHCDQYYECVSEVLHSRACPV 202
            :.::..|.:.:..|| ::.|......|:.     .|::.      :|:.:|:|.|..|..:.||.
  Fly   190 NSLTGKCDHPENVRC-LAMTYNPREQCKRHVIDVYPHSD------NCNYFYQCRSGYLMVQQCPF 247

  Fly   203 ASAYDANLGYCVDVAEVSCY 222
            ...:|.....||.:.:..||
  Fly   248 FYGWDYEKRSCVALGQAKCY 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 11/54 (20%)
ChtBD2 246..290 CDD:214696
CBM_14 303..348 CDD:279884
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 9/47 (19%)
CBM_14 160..202 CDD:279884 8/43 (19%)
ChtBD2 215..259 CDD:214696 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.