DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG33986

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:318 Identity:67/318 - (21%)
Similarity:104/318 - (32%) Gaps:121/318 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CILASSSAAVCP----YADSIADKATNLCANETEGAFIVDPSSSDCRGYILC-KSHKQIKANCPN 138
            |:||::.....|    .:.:|....:.:|||...|.|:  ..:.||..:.|| ::...:.|:||.
  Fly    13 CLLATAQLTWRPSKPTNSVTIRQSGSRICANHLVGEFV--EHAEDCHMFYLCVENGDAVLASCPP 75

  Fly   139 ELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVA 203
            .::|:..||.|            ...|:..||   |.|   ||:.                   .
  Fly    76 TMLFNSESRLC------------DSATNVKCR---NET---DPIE-------------------T 103

  Fly   204 SAYDANLGYCVDVAEVSCYESAALPEPEN------TFC---LDSATGSARVGYFADDESCSHYYI 259
            ..:|...|.               .:|.|      |:|   ::....|.|:.|.....||..|||
  Fly   104 PPFDGGNGD---------------GDPNNMVTDAATYCSTLVEQQQSSDRIVYVGSSSSCRKYYI 153

  Fly   260 C---------------GSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNVRCQLDRCVGTNIT 309
            |               .:.:.||.|. |:...|.:|.                 |.|.....|..
  Fly   154 CYYGQAILQECSSQLHWNAMTGKCDI-PERAQCTVGG-----------------QEDMPTNGNSG 200

  Fly   310 YVN----VAGD---CQSYG--------RCSGGV-----TVSLGQCPTGYYFDERNQGC 347
            :.:    ::.|   |.:||        ||...:     ..||.|||..|:||...:.|
  Fly   201 FPSGGTAISSDLIHCPAYGQHLYPHMQRCEFFIYCVKGHASLQQCPFYYFFDIATKSC 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 16/52 (31%)
ChtBD2 246..290 CDD:214696 13/58 (22%)
CBM_14 303..348 CDD:279884 16/65 (25%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 17/64 (27%)
CBM_14 141..185 CDD:279884 11/44 (25%)
ChtBD2 213..261 CDD:214696 14/46 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.