DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG4835

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:466 Identity:86/466 - (18%)
Similarity:143/466 - (30%) Gaps:164/466 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GVIEDFEYLSVAEMCDLLPQETSFLR-PNTCDNWVRCASNYSVLEQGGCAAGLNYNKELGRC--- 79
            |:.||:        |  :|:...|.. |..|..::.|.:..:.|:.  |.....:|..|..|   
  Fly   267 GIEEDY--------C--VPKGNGFYEYPYNCSGYLACKNGCTDLDY--CQPDKLFNNWLHICDTP 319

  Fly    80 -------------------------------------------------ILASSSAAVCPYADSI 95
                                                             |.:|::..:....|.:
  Fly   320 DSVRCDPLPFPTTPGTTNKPTTPSVTTTPSITTTPSTPTTLPSDGSTTEIHSSTTEEIVTTTDGL 384

  Fly    96 -ADKATNLCANETEG---AFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYR 156
             :|...|.|.:|.:|   |:|     .:|..|::||.::....:||...:|:|....|.......
  Fly   385 PSDVDPNDCKDEKDGTIFAYI-----GNCSEYLICKDNQVQMGHCPPNTLFNPDLLVCDEPDDVV 444

  Fly   157 C-------------PISQTKKTSPACRSLPNNTRLAD---------------PVHCDQYYECVSE 193
            |             |.:.|:||:|...:....|.|..               |..|.:||.|:..
  Fly   445 CLGDRTTTPIPTTIPTTTTEKTTPTTTTTTVATTLGPDQLCDGQELGASFSYPDDCSKYYLCLGG 509

  Fly   194 VLHSRA-CPVASAYDANLGYC-VDVAEVSCY------------------------ESAALPEPEN 232
            ...:.| |...|.:|.:.|.| .|||..:|.                        :|.|......
  Fly   510 GQWTLAPCIYGSYFDPSTGQCGPDVAPDACKPSQVTTTTTTTTTETTTTERNTTPKSTATTTERT 574

  Fly   233 TFCLDSATG-------SARVGYFADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDFEKLSC 290
            |..:...||       :..:.|   ..:|:.|.:|.||:       |....||.|.:|..:...|
  Fly   575 TTTVAPKTGICGGRNENENIAY---PNNCTKYIVCVSPI-------PIAFFCPDGTFFSSKLEKC 629

  Fly   291 RDRLNVR-CQLDR------------------CVGTNITYVNVAGDCQSYGRCSGGVTVSLGQCPT 336
            .|..:.. |:.|:                  |..::........:||.:.||.......:..|..
  Fly   630 IDDWDESDCEGDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQWFIRCVDDYIYMMDVCNC 694

  Fly   337 GYYFDERNQGC 347
            |.|:|...:.|
  Fly   695 GEYYDPITEKC 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 14/54 (26%)
ChtBD2 246..290 CDD:214696 11/43 (26%)
CBM_14 303..348 CDD:279884 10/45 (22%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884 11/52 (21%)
CBM_14 393..444 CDD:279884 14/55 (25%)
CBM_14 485..539 CDD:279884 14/53 (26%)
CBM_14 585..638 CDD:279884 13/62 (21%)
CBM_14 661..714 CDD:279884 10/45 (22%)
CBM_14 744..796 CDD:279884
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443999
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.