Sequence 1: | NP_001262095.1 | Gene: | CG7017 / 40213 | FlyBaseID: | FBgn0036951 | Length: | 359 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_647708.1 | Gene: | CG13806 / 38292 | FlyBaseID: | FBgn0035325 | Length: | 297 | Species: | Drosophila melanogaster |
Alignment Length: | 282 | Identity: | 66/282 - (23%) |
---|---|---|---|
Similarity: | 82/282 - (29%) | Gaps: | 104/282 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 IADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPI 159
Fly 160 ---SQTKKTSPACR--SLPNNTR------LADPVHCDQYYEC--VSEVLHSRA--CPVASAYDAN 209
Fly 210 LGYC-VDVAEVSCYES----------AALPEPENTF-----------------------CLDSAT 240
Fly 241 --------GS-----------------------------ARVGYFADDESCSHYYICGSPVAGKH 268
Fly 269 DTEPKHLSCPLGQYFDFEKLSC 290 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7017 | NP_001262095.1 | CBM_14 | 103..155 | CDD:279884 | 12/51 (24%) |
ChtBD2 | 246..290 | CDD:214696 | 15/43 (35%) | ||
CBM_14 | 303..348 | CDD:279884 | |||
CG13806 | NP_647708.1 | CBM_14 | 105..158 | CDD:279884 | 14/52 (27%) |
ChtBD2 | 247..293 | CDD:214696 | 18/51 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444106 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |