DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG13806

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_647708.1 Gene:CG13806 / 38292 FlyBaseID:FBgn0035325 Length:297 Species:Drosophila melanogaster


Alignment Length:282 Identity:66/282 - (23%)
Similarity:82/282 - (29%) Gaps:104/282 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 IADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPI 159
            |..:.||.|    ||.....|....|.....|..|.....|.|.|        ||.....|.|..
  Fly    29 IQPRETNSC----EGRQSPGPICESCELLATCVRHSNGWVNIPVE--------SCDVANGYYCNA 81

  Fly   160 ---SQTKKTSPACR--SLPNNTR------LADPVHCDQYYEC--VSEVLHSRA--CPVASAYDAN 209
               |.|.:|.| |.  .:..|.:      ..||..|.:|:.|  |...|.:.|  |....|:||.
  Fly    82 RLGSCTNETGP-CHPFGIEGNFQCTSQGIFPDPYDCQKYHMCYFVGATLVAAAVDCGNDKAFDAT 145

  Fly   210 LGYC-VDVAEVSCYES----------AALPEPENTF-----------------------CLDSAT 240
            .|.| :.:.:..|.:.          ||.|...|.|                       |.|..|
  Fly   146 TGQCTLTLTDSVCLQRQYYCPNAGHVAAWPTNPNIFYVCKSTVNQNLNDTIVIYPSLHRCNDGET 210

  Fly   241 --------GS-----------------------------ARVGYFADDESCSHYYICGSPVAGKH 268
                    ||                             ..||..||...|..||.| |.:.|  
  Fly   211 FVDYVCRSGSNVLPPSTDDPSVIIEDPNDDDFSVLPNTCQHVGLMADGNDCRKYYYC-SALNG-- 272

  Fly   269 DTEPKHLSCPLGQYFDFEKLSC 290
              ..:|:.||.|.|:..|..||
  Fly   273 --TLRHMDCPNGTYYRPELSSC 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 12/51 (24%)
ChtBD2 246..290 CDD:214696 15/43 (35%)
CBM_14 303..348 CDD:279884
CG13806NP_647708.1 CBM_14 105..158 CDD:279884 14/52 (27%)
ChtBD2 247..293 CDD:214696 18/51 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.