DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and obst-E

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_723116.1 Gene:obst-E / 33806 FlyBaseID:FBgn0031737 Length:249 Species:Drosophila melanogaster


Alignment Length:233 Identity:55/233 - (23%)
Similarity:80/233 - (34%) Gaps:60/233 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CILASSSAAV----CPYADSIADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPNE 139
            |:....|.|:    ||               ...|.|   .|...|..|..|:....::..||:.
  Fly    11 CVAMFGSMALGSPECP---------------TPNGRF---ASGDQCDSYTECQDGTPVEKLCPDG 57

  Fly   140 LIFHPVSRS---CVYEKQYRC-------PISQTKKTSPACRSLPNNTRLADPVHCDQYYECVSEV 194
            |:||..:::   |.|.....|       |.:.|::........||    .|...|..|..|...|
  Fly    58 LLFHQRTKATGECTYAPYSTCKERARLQPANGTEECPRQFGFYPN----GDATKCGVYRNCAHGV 118

  Fly   195 LHSRACPVASAYDANLGYC--VDVAEVSCYESAALPEPENTFCLDSATGSA----------RVGY 247
            .....||...|::.....|  .|:.| ||...|.|  ..|....|||..||          .:.|
  Fly   119 ASLTKCPEGLAFNEETYQCDWPDLVE-SCNAEAYL--GFNCPAADSADDSAAAAVDVSPEGELRY 180

  Fly   248 FADDESCSHYYICGSPVAGKHDTEPKHLSCPLGQYFDF 285
            :...::|..|::|   |.|    .|:..:|  |:|..|
  Fly   181 YRHPQTCKKYFVC---VNG----HPRLYNC--GKYLAF 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 13/54 (24%)
ChtBD2 246..290 CDD:214696 11/40 (28%)
CBM_14 303..348 CDD:279884
obst-ENP_723116.1 ChtBD2 23..65 CDD:214696 13/59 (22%)
CBM_14 95..146 CDD:307643 13/55 (24%)
CBM_14 180..225 CDD:307643 11/39 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.