DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and Peritrophin-A

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_523418.1 Gene:Peritrophin-A / 33023 FlyBaseID:FBgn0022770 Length:230 Species:Drosophila melanogaster


Alignment Length:220 Identity:54/220 - (24%)
Similarity:72/220 - (32%) Gaps:45/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 SPACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYD--------ANLGYCVDVAEVSCY 222
            ||.|.........|...:|||::.|.:..|....|.....:|        .|..:.||     |.
  Fly    25 SPECPEKYGVQAYAHTENCDQFFLCTNGTLTLETCENGLLFDGKGAVHNHCNYNWAVD-----CK 84

  Fly   223 ESAALPEPENTFCLDSATGSARVGYFADDESCSHYYI-CGSPVAGKHDTEPKHLSCPLGQYFDFE 286
            .....|.|.:|...:     .:.|.:|..:.||..|| |.      |. ||....|..|..:|..
  Fly    85 GRQWDPTPISTPACE-----YQFGLYAVSKDCSTTYIKCA------HG-EPHEQDCDAGLAYDER 137

  Fly   287 KLSCR--DRLNVRCQLDRCVGTNI-TYVN---------------VAGDCQSYGRCSGGVTVSLGQ 333
            ...|.  |:|...|..:..||... |.|:               |||||.....|..| ...|..
  Fly   138 IHGCNWPDQLLEHCNPEAVVGFKCPTKVDPNSVAARFWPFPRFPVAGDCHRLITCVEG-HPRLIS 201

  Fly   334 CPTGYYFDERNQGCTQTNYHNIACS 358
            |.....|||....|....|.:.:|:
  Fly   202 CGEDKVFDEHTLTCEDPEYASGSCA 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884
ChtBD2 246..290 CDD:214696 13/44 (30%)
CBM_14 303..348 CDD:279884 16/60 (27%)
Peritrophin-ANP_523418.1 CBM_14 36..83 CDD:279884 11/51 (22%)
CBM_14 103..147 CDD:279884 15/50 (30%)
ChtBD2 179..218 CDD:214696 13/39 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.