DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and obst-A

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001245778.1 Gene:obst-A / 33022 FlyBaseID:FBgn0031097 Length:237 Species:Drosophila melanogaster


Alignment Length:238 Identity:57/238 - (23%)
Similarity:86/238 - (36%) Gaps:61/238 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 KQYRCPISQT----KKTSPACRSLPN-NTRLADPVHCDQYYECVSEVLHSRACPVASAYD---AN 209
            |.:.|.|:.|    ...|.|....|. |.:.||.|.||::|.|...|..::.||....:|   ..
  Fly     2 KLFLCAIAVTLCVATTVSAANFECPKPNGQFADEVQCDKFYVCDDGVAKAKLCPDGLVFDPLNRK 66

  Fly   210 LGYCVDVAEVSCYESAALPEPENT-FCLDSATGSARVGYFA--DDESCSHYYICGSPVAGKHDTE 271
            ...|.....|.|.:...|.||::: :|      ..:.|:||  |...|:.:|.|   :.|    :
  Fly    67 FNKCDQPFNVDCEDRTELQEPKSSKYC------PRKNGFFAHPDPAVCNIFYNC---IEG----D 118

  Fly   272 PKHLSCPLGQYFDFEKLSC-------RDRLNVR---------CQLDR-------CVGTNITYVNV 313
            .....|.:|.:||....:|       |:..|..         |..|:       .|.|:..|.:.
  Fly   119 ALETKCTVGLHFDEYSGTCVWPDTAKREGCNPEQRTSETGFVCPKDQPKTDDRGQVVTHPKYPHP 183

  Fly   314 AGDCQSYGRCSGGVTVSLGQCPTGYYFDERNQGCTQTNYHNIA 356
            . |||.:..|..|.             |.|:.||.....:|.|
  Fly   184 T-DCQKFYVCLNGE-------------DPRDLGCQLGEVYNDA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 1/1 (100%)
ChtBD2 246..290 CDD:214696 12/45 (27%)
CBM_14 303..348 CDD:279884 11/44 (25%)
obst-ANP_001245778.1 CBM_14 27..77 CDD:366726 13/49 (27%)
CBM_14 95..143 CDD:366726 13/54 (24%)
CBM_14 180..225 CDD:366726 12/47 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452816
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.