DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and Mur2B

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001284789.1 Gene:Mur2B / 31111 FlyBaseID:FBgn0025390 Length:1795 Species:Drosophila melanogaster


Alignment Length:268 Identity:59/268 - (22%)
Similarity:78/268 - (29%) Gaps:103/268 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RCASNYSVLEQ------------------GGCAAGLNYNKELGRCILASSSAAVCPYADSIADKA 99
            ||:.||..::.                  ..|....::|...|||        |........|..
  Fly    89 RCSRNYIGIKPHPDQQQYYYVCKPDCVIFSKCRGLESFNASSGRC--------VQHVPQHRPDHR 145

  Fly   100 TNLCANETEGAFIVDPSSSDCRGYILCKSHKQ---IKANCPNELIFHPVSRSCVYEKQYRCPISQ 161
            ...|  :.||.|   |...||:.|..|..::.   :.| ||...||.||.|.|:...|  ||   
  Fly   146 PPQC--QKEGRF---PHPHDCKVYYRCDKNRTQPWLFA-CPAGTIFSPVERKCLPGDQ--CP--- 199

  Fly   162 TKKTSPACRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYCVDVAEVSCYESAA 226
            :.:.|.:...:|.|..|..|       ||..|                                 
  Fly   200 STEISDSGSYIPQNCELKFP-------ECAEE--------------------------------- 224

  Fly   227 LPEPENTFCLDSATGSARVGYFADDESCSHYYICGSPVAGKH-DTEPKHLSCPLGQYFDFEKLSC 290
                               |.|.....|:.||.|....:|.: .|..|   ||....||.|:..|
  Fly   225 -------------------GTFRSPTDCALYYTCRLQESGTYLQTRFK---CPGSNSFDLERKLC 267

  Fly   291 RDRLNVRC 298
            |.|..|.|
  Fly   268 RPRSEVDC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 18/54 (33%)
ChtBD2 246..290 CDD:214696 14/44 (32%)
CBM_14 303..348 CDD:279884
Mur2BNP_001284789.1 ChtBD2 88..136 CDD:214696 10/54 (19%)
CBM_14 150..197 CDD:279884 17/50 (34%)
CBM_14 221..275 CDD:279884 20/108 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.