DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and Muc68E

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_996064.1 Gene:Muc68E / 2768990 FlyBaseID:FBgn0053265 Length:1799 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:105/288 - (36%) Gaps:67/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 DSIADKA------TNLCANETE-GAFIVDPSSSDCRGYILCKSHKQIKANCPNELIF----HPV- 145
            |:..|::      ||:....|. |...:.|..:...|.:          :....|::    .|: 
  Fly  1544 DTTTDESSTVVTTTNIPKESTTLGDSTLSPGENSTAGQV----------STSTTLVYDTTSSPIP 1598

  Fly   146 --SRSCVYE-KQYRCPISQTKKTSP-ACRS----LPNNTRLADPVHCDQYYECVSEVLHSRACPV 202
              |||...| .....|.:.|....| :|.:    ||:.|.....:||...:|.:.|      ||.
  Fly  1599 SSSRSTTLEPSSSSSPETTTSSLPPLSCSTGYQYLPHPTNCHKYIHCSNGHELIME------CPA 1657

  Fly   203 ASAYDANLGYCVDVAEVSCYESAALPEPENTFCLDSATGSARVGYFADDESCSHYYICGSPVAGK 267
            ...:|.:...|...:.| ||.......||...|      ...|.:.|....|:.|..|.:.||  
  Fly  1658 NLYWDYHKFVCSGDSGV-CYNDTENSNPEEKVC------GPGVDFLAHPTDCTMYLQCSNGVA-- 1713

  Fly   268 HDTEPKHLSCPLGQYFDFEKLSCRDRLNVRC-------QLDRCVGTNITYVNV-AGDCQSYGRCS 324
              .|.|   ||...|::.|..|| |..|..|       .:....|.|.   || ..||..|.:|.
  Fly  1714 --LERK---CPDPLYWNPEIKSC-DWSNKYCTNLRASQSISCAAGMNF---NVFQSDCSKYVKCF 1769

  Fly   325 G--GVTVSLGQCPTGYYFDERNQGCTQT 350
            |  ||.:|   |.:|.|::..:|.|.::
  Fly  1770 GLRGVVMS---CNSGLYWNPVSQVCEKS 1794

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 10/60 (17%)
ChtBD2 246..290 CDD:214696 12/43 (28%)
CBM_14 303..348 CDD:279884 16/47 (34%)
Muc68ENP_996064.1 ChtBD2 <1761..1791 CDD:214696 12/32 (38%)
ChtBD2 1626..1668 CDD:214696 11/47 (23%)
ChtBD2 1688..1734 CDD:214696 17/59 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.