DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and cbd-1

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_502145.2 Gene:cbd-1 / 178061 WormBaseID:WBGene00010351 Length:1319 Species:Caenorhabditis elegans


Alignment Length:411 Identity:84/411 - (20%)
Similarity:113/411 - (27%) Gaps:161/411 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SFLRPNTC-DNWVRCASNYSVLEQGGCAAGLNYNKELGRC---------ILA------------- 82
            :||....| |.::.|:.| .:.....|..|..::|.|..|         |:|             
 Worm   576 TFLTFGDCFDQFIFCSGN-GINRMAACPIGETFDKTLRSCSETCGVSTTIVAVTIGTQTSDDLSA 639

  Fly    83 ------------------SSSAAVCPYADSIADKATNLCANE---TEGAFIVDPSSSDCRG---- 122
                              ..|....|  :|.....|...:|:   |..|.|.|..|.|..|    
 Worm   640 PSEYIENDGVTTQSTWNDQPSTTQAP--NSYESYTTQYSSNDVPSTSAAPIGDRCSLDASGLFSL 702

  Fly   123 -----YILCKSHKQIKANCPNELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPNNTRLADPV 182
                 ||.|.:...|...|...|.|:..::.|.|.                              
 Worm   703 GCSQKYIQCSNGAAIVRRCGESLYFNEATQECTYR------------------------------ 737

  Fly   183 HCDQYYECVSEVLHSRACPVAS--AYDANLGYCVDVAEVSCYESAALPEPENTFCLDSATGSARV 245
              |:..||.|:  .|.:.||.:  ..|.:..|            ..:|..:......:..|. |.
 Worm   738 --DEVPECGSQ--GSTSSPVITTPGQDQSSNY------------YGIPSDDVPSTTQTPVGD-RC 785

  Fly   246 GYFAD---DESCSHYYI-CGSPVAGKHDTEPKHLSCPLGQYFDFEKLSCRDRLNV-RCQ-LDRCV 304
            .|.|.   |..||..|| |....|...:       |....|||....|||.|..| :|| .|...
 Worm   786 AYVASGLFDLGCSQKYIQCSDSAASVRE-------CEGSLYFDERSQSCRFRDEVFKCQTADVSS 843

  Fly   305 GTNITY------------------------------VNVAGDCQS-------------YGRCSGG 326
            .:.:.|                              ||....|.|             |..||.|
 Worm   844 SSTVPYLDFTTTPASPSEDEPTTYEPSVAPYIPSVTVNPVDTCTSLSDGTHGTGCSSFYFVCSHG 908

  Fly   327 VTVSLGQCPTGYYFDERNQGC 347
            ..:|.|.|..|..:|...|||
 Worm   909 RLISSGNCQLGEGYDPSVQGC 929

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 17/63 (27%)
ChtBD2 246..290 CDD:214696 13/47 (28%)
CBM_14 303..348 CDD:279884 17/88 (19%)
cbd-1NP_502145.2 ChtBD2 97..141 CDD:214696
ChtBD2 191..237 CDD:214696
CBM_14 692..743 CDD:307643 13/82 (16%)
CBM_14 785..836 CDD:307643 18/57 (32%)
CBM_14 1108..1161 CDD:307643
CBM_14 1182..1235 CDD:307643
CBM_14 1251..1296 CDD:307643
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.