DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and LOC1271136

DIOPT Version :10

Sequence 1:NP_649190.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_061512597.1 Gene:LOC1271136 / 1271136 VectorBaseID:AGAMI1_009045 Length:640 Species:Anopheles gambiae


Alignment Length:213 Identity:55/213 - (25%)
Similarity:85/213 - (39%) Gaps:35/213 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VASALGGVIEDFEYLSVA----EMCDLLPQETSFLRPNTCDNWVRCASNYSVLEQGGCAAGLNYN 73
            |...|.|.:|:..::.||    |:|:.......|..|..|..::.|.....:::  .|:.||.:|
Mosquito    68 VQICLLGQMEEQSHVEVAFQFEELCNNPDVVQIFPNPTNCTQYILCYGTVPIVQ--SCSGGLLFN 130

  Fly    74 KELGRCILASSSAAVCPYADSIADKATNLCANETEGAFIVDPSSSDCRGYILCKSHKQIKANCPN 138
            .:|..|.:..:  .||.|:....|...|       ..::.|....||..:.||...:.::..|.:
Mosquito   131 PQLNTCDVPGN--VVCGYSCPSVDDPYN-------PVWLPDARLQDCSRHYLCFKGEPLQFQCYS 186

  Fly   139 ELIFHPVSRSCVYEKQYRCPISQTKKTSPACRSLPN---NTRLA----DPVHCDQYYECVSEVLH 196
            .|.|...:|:|.| .||           ..|| :||   ||.|.    :|..|..||.||....|
Mosquito   187 NLYFDIETRTCTY-PQY-----------STCR-VPNVYCNTTLTVNVENPRSCTSYYTCVEGFPH 238

  Fly   197 SRACPVASAYDANLGYCV 214
            .|.|.....:...||.|:
Mosquito   239 YRTCGYEEYFSVPLGMCI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_649190.1 CBM_14 103..155 CDD:426342 11/51 (22%)
ChtBD2 246..290 CDD:214696
CBM_14 303..348 CDD:426342
LOC1271136XP_061512597.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.