DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and LOC110437948

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_021322240.1 Gene:LOC110437948 / 110437948 -ID:- Length:195 Species:Danio rerio


Alignment Length:163 Identity:41/163 - (25%)
Similarity:50/163 - (30%) Gaps:64/163 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   221 CYESAALPE----------PENTFCLDSATG--SARVGYFADDESCSHYYICGSPVAGKHDTEPK 273
            |.|.|..|.          ||..:|...||.  ....|.|......|..:.|   .||.:..:..
Zfish    16 CTEKAESPTPIDGITGHVCPEGHYCPPGATRPVPCHSGTFVTVPQASQCWAC---TAGWYCADGG 77

  Fly   274 HLSCPLGQYFDFEKLSCRDRLNVRCQLDRCVGTNI--------TYVNVAG-----DCQSYGRCSG 325
            .|.||.|.|       |.:            ||..        ||...:|     :|::   |.|
Zfish    78 RLLCPAGFY-------CPE------------GTGYDIRPCPAGTYSPDSGLISLSECRA---CDG 120

  Fly   326 GVTVSL-------GQCPTGYYFDERNQGCTQTN 351
            |...||       |||..|||       |.|.|
Zfish   121 GHYCSLQNSSSVTGQCSEGYY-------CAQGN 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884
ChtBD2 246..290 CDD:214696 11/43 (26%)
CBM_14 303..348 CDD:279884 17/64 (27%)
LOC110437948XP_021322240.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.