DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and CG42728

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:NP_001189111.1 Gene:CG42728 / 10178859 FlyBaseID:FBgn0261681 Length:156 Species:Drosophila melanogaster


Alignment Length:129 Identity:34/129 - (26%)
Similarity:48/129 - (37%) Gaps:33/129 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 EGAFIVDPSSS------DCRGY--ILCKSHKQIKAN--CPNELIFHPVSRSCVYEKQYRCPISQT 162
            :..||.:..|:      :|.|.  :.|..:....||  |.:.|   ||..|..      .|||.|
  Fly    34 QNGFINNTRSNCNYSLINCSGQNSMFCTDNTTCNANFTCSDIL---PVDNSTA------LPISTT 89

  Fly   163 KK--------TSPA-----CRSLPNNTRLADPVHCDQYYECVSEVLHSRACPVASAYDANLGYC 213
            ..        .||:     ||. ....|.:.|.:|:.:|.||...|....||:..|:|...|.|
  Fly    90 PNVVTTASTTVSPSDIRRECRQ-GVTKRFSYPQNCNYFYYCVDGFLLVEQCPIGYAFDPQTGAC 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 13/56 (23%)
ChtBD2 246..290 CDD:214696
CBM_14 303..348 CDD:279884
CG42728NP_001189111.1 CBM_14 117..152 CDD:279884 11/34 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.