DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7017 and si:ch211-286b4.4

DIOPT Version :9

Sequence 1:NP_001262095.1 Gene:CG7017 / 40213 FlyBaseID:FBgn0036951 Length:359 Species:Drosophila melanogaster
Sequence 2:XP_021322239.1 Gene:si:ch211-286b4.4 / 100005359 ZFINID:ZDB-GENE-131127-605 Length:2996 Species:Danio rerio


Alignment Length:403 Identity:84/403 - (20%)
Similarity:123/403 - (30%) Gaps:147/403 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 CDNWVRCASNYSVLEQGGCAAGL-----------NYNKELGR-------CILASSSAAVCP---Y 91
            ||....|..:.:|...|.|:||.           |.| |.|.       |...|.:...||   :
Zfish   792 CDPGTYCMGSGNVSPTGPCSAGFLCFGGAVLSSPNDN-ETGMLCPSGFYCPAGSFAGIPCPKGTF 855

  Fly    92 ADSIADKATNLCANETEGAFIVDPS----SSDC-RGYI-----------------------LCKS 128
            ::|......:.|.|.|.|.:..:|.    |..| .||.                       .|..
Zfish   856 SNSSQLSKISQCQNCTPGFYCSEPGLTAVSGPCLPGYYCSEGSPSAAPVSAVYGSVCPPGHYCVV 920

  Fly   129 HKQIKANCPNELIFHPVSRSCVYEKQYRCPIS--QTKKTSPACRSLP----------NNTRLADP 181
            ...:.|.||.. ...|.||....:....||..  |.::....|:..|          .:|.::.|
Zfish   921 GSAVPAPCPVG-TRRPDSRGKATDDCMPCPGGQFQDQRGQSECKPCPTGFHCINLTSGSTGVSSP 984

  Fly   182 VHCDQYYECVSEVLHSR--ACPVASAYDANLG--------------YC--VDVAEVS-------- 220
            :.|.:.:.|.:|.....  .|| ...|..:||              :|  |.::..|        
Zfish   985 IICPEGFYCPNETQSGNPVPCP-KGTYSDSLGLISAEQCLVCPMGYFCGSVGLSNPSGACAPGFL 1048

  Fly   221 CYESAALPEPENTFCLDSATGS-----------ARVGYFADDESCSHYYIC--GSPVAGKHDTEP 272
            |:..|.:|.|     .|::|||           .|.|      .||..|.|  ||       :.|
Zfish  1049 CFVQATVPNP-----TDNSTGSLCPPGAFCLLGTRAG------ECSEGYYCDWGS-------SSP 1095

  Fly   273 KHLSCPLGQYFDF---EKLSCRDRLNVRCQLDRCVGTNITYVNVAGD--------CQSYGRCSGG 326
            :...||.|.|...   :.|:|               |..|:.:|.|:        |.....|.|.
Zfish  1096 EQSLCPAGFYCPAGTNKPLAC---------------TGGTFSSVMGNSHRENCEPCPLGFYCQGD 1145

  Fly   327 VTVSLGQCPTGYY 339
            .......||.|::
Zfish  1146 AVAEPLPCPPGHF 1158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7017NP_001262095.1 CBM_14 103..155 CDD:279884 16/79 (20%)
ChtBD2 246..290 CDD:214696 13/48 (27%)
CBM_14 303..348 CDD:279884 10/45 (22%)
si:ch211-286b4.4XP_021322239.1 Ephrin_rec_like <945..983 CDD:311571 6/37 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.