DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG42397

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001163428.1 Gene:CG42397 / 8673976 FlyBaseID:FBgn0259748 Length:178 Species:Drosophila melanogaster


Alignment Length:114 Identity:30/114 - (26%)
Similarity:45/114 - (39%) Gaps:27/114 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CNAWIQCIDGSPVSGSCATGLFYDRE-------SQKC-------LSSSSIKCLSSDPCAALPTGF 94
            |..:.||:.|..:...|..||::|||       ||.|       .:.|::.|.|..|..      
  Fly    68 CREYYQCLYGEGILKICPDGLYWDRELNVCAWDSQ
HCADDKNETTTPSTLNCASGLPFL------ 126

  Fly    95 AADPY--SCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMD 141
               ||  .|..:..|....|....|.:|:.:|...|.|  |:.|.|.::
  Fly   127 ---PYIPDCTKFIQCVYNIGFKLSCPSGLYWNQPLQSC--DYTCDNAIE 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 12/35 (34%)
ChtBD2 85..130 CDD:214696 10/46 (22%)
CBM_14 146..196 CDD:279884
CBM_14 273..322 CDD:279884
CG42397NP_001163428.1 CBM_14 58..102 CDD:279884 10/33 (30%)
ChtBD2 125..163 CDD:214696 10/48 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.