DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and AgaP_AGAP011614

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001689300.1 Gene:AgaP_AGAP011614 / 5668000 VectorBaseID:AGAP011614 Length:292 Species:Anopheles gambiae


Alignment Length:176 Identity:38/176 - (21%)
Similarity:59/176 - (33%) Gaps:24/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 MNDPRACNAWIQCIDGSPVSGSCATGLFYDRESQKCLSSSSIKC--------LSSDPCAALPTGF 94
            :..|.:|..:|.|........:|.....:|.:...|:..:...|        |.:|.|..:..|.
Mosquito    94 LEHPSSCYKYISCYKEVATEETCPPDTIFDLDEITCVP
GNQRTCRKEGDPYPLPTDMCRGIVLGT 158

  Fly    95 AADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFP-----CSNKMDPDSYCNILPDGVF 154
            ...|..||.|..|..|:.....|..|..|:.....|:   |     |:..:.|.: ..|.|:.:.
Mosquito   159 MVHPEDCNKYVSCLLGQARERSCRPGFVFSERLFVCL---P
GDLNSCTVTLLPTT-STIAPEDIR 219

  Fly   155 VKDTDNCNGYQLCWDGQVINGTCP-GTFYFKASTAQCDYPQNVECD 199
            ...:|      :|....|..|..| ..|..|..|.....|...:||
Mosquito   220 PLPSD------ICRRNSVAFGVLPHPQFCTKYVTCTLWIPAERDCD 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 6/34 (18%)
ChtBD2 85..130 CDD:214696 12/44 (27%)
CBM_14 146..196 CDD:279884 11/50 (22%)
CBM_14 273..322 CDD:279884
AgaP_AGAP011614XP_001689300.1 ChtBD2 84..131 CDD:214696 7/36 (19%)
CBM_14 151..196 CDD:279884 12/47 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.