DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and AgaP_AGAP006432

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_001237816.1 Gene:AgaP_AGAP006432 / 4576210 VectorBaseID:AGAP006432 Length:373 Species:Anopheles gambiae


Alignment Length:122 Identity:26/122 - (21%)
Similarity:39/122 - (31%) Gaps:60/122 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMDPDSYCNILP 150
            |.|.|| .:.|....|:.||.|.:|                   |:::|.|             |
Mosquito   292 PGATLP-NYWAHGTDCSRYYGCLEG-------------------CVKEFKC-------------P 323

  Fly   151 DGVFVKDTD-NCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDI 206
            ||::..|.. .|:.|                     |::||..|     |..|.|::
Mosquito   324 DGLYWNDQQKRCDSY---------------------SSSQCGCP-----DIPPAPNM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 10/43 (23%)
CBM_14 146..196 CDD:279884 10/50 (20%)
CBM_14 273..322 CDD:279884
AgaP_AGAP006432XP_001237816.1 ChtBD2 38..83 CDD:214696
ChtBD2 287..336 CDD:214696 17/76 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.