powered by:
Protein Alignment CG6996 and AgaP_AGAP006432
DIOPT Version :9
Sequence 1: | NP_001262094.1 |
Gene: | CG6996 / 40212 |
FlyBaseID: | FBgn0036950 |
Length: | 364 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001237816.1 |
Gene: | AgaP_AGAP006432 / 4576210 |
VectorBaseID: | AGAP006432 |
Length: | 373 |
Species: | Anopheles gambiae |
Alignment Length: | 122 |
Identity: | 26/122 - (21%) |
Similarity: | 39/122 - (31%) |
Gaps: | 60/122 - (49%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 PCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMNFNSGTQDCIRDFPCSNKMDPDSYCNILP 150
|.|.|| .:.|....|:.||.|.:| |:::|.| |
Mosquito 292 PGATLP-NYWAHGTDCSRYYGCLEG-------------------CVKEFKC-------------P 323
Fly 151 DGVFVKDTD-NCNGYQLCWDGQVINGTCPGTFYFKASTAQCDYPQNVECDFVPVPDI 206
||::..|.. .|:.| |::||..| |..|.|::
Mosquito 324 DGLYWNDQQKRCDSY---------------------SSSQCGCP-----DIPPAPNM 354
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D487374at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.920 |
|
Return to query results.
Submit another query.