DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6996 and CG17147

DIOPT Version :9

Sequence 1:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:357 Identity:98/357 - (27%)
Similarity:158/357 - (44%) Gaps:52/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDTKLAFISGLIMIPTISGALTFNATL-----ICSLVVNGTKMNDPRACNAWIQCIDGSPVSGSC 60
            ::.||..:.|.::   :...:..:|::     :|.|..||||:..|..|:.:|||.||:....:|
  Fly     2 LNLKLGVLLGCVL---LLATVALSASVGEYEELCRLFKNGTKVRKPGTCDQYIQCYDGNGTVLTC 63

  Fly    61 ATGLFYDRESQKC---LSSSSIKCLSSDPCAALPTGFAADPYSCNGYYYCKDGKGTHGVCNTGMN 122
            .:...::.....|   |::|:..|  .:.|..|...:.|||..|:.|:||.:|....|:|..|.:
  Fly    64 PSNQSFNPSKGSCVDTLANSNKYC--GNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQH 126

  Fly   123 FNSGTQDCIR--DFPCSNKMDPDSYCNILPDGVFVKDTDNCNGYQLC-WDGQVINGTCPGTF--- 181
            |:..:|.|:.  |..|   :|.::.|.::.:....::..:|..|..| ..|...:.:|..|.   
  Fly   127 FDERSQSCLYGVDSMC---VDVNNICELVAENTKFRNEKDCAYYYECDKTGNHASKSCTVTSKKR 188

  Fly   182 -YFKASTAQCDYPQNVECDFVPVPDISKKGVCPE--TGGFISDNKTCNGYYYCKDLGNGEFSLEH 243
             ||...:..|.....|||     ...||:.||..  |..|.||..||.||:.||.|        :
  Fly   189 EYFDVESGNCVEANKVEC-----TAHSKENVCTSSTTMTFKSDQATCRGYFVCKAL--------Y 240

  Fly   244 GV---------CSDGRFFLATDGGACVPRSKVKCGYDRCVGLGNSTIQLANESDDGCRGYSICQD 299
            .|         |.:|.|| ..|...|...:.|.|.::||.|.|.   .|...|.:.|..|..|.|
  Fly   241 PVADLDPLWTQCPEGYFF-DEDRQLCANPTTVVCTHNRCDGRGT---MLVTSSSNNCHNYIRCVD 301

  Fly   300 GIVIGQGTCPQDEYFDEITQRCTTQVISYTAC 331
            ...:.:.||..|.:|||..:.|::::| |..|
  Fly   302 NKEVTEETCHWDHFFDETVEACSSKII-YDKC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884 14/43 (33%)
ChtBD2 85..130 CDD:214696 15/44 (34%)
CBM_14 146..196 CDD:279884 10/54 (19%)
CBM_14 273..322 CDD:279884 15/48 (31%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 8/32 (25%)
ChtBD2 89..136 CDD:214696 16/46 (35%)
CBM_14 278..332 CDD:279884 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D487374at33208
OrthoFinder 1 1.000 - - FOG0005299
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.